Property Summary

NCBI Gene PubMed Count 14
Grant Count 154
R01 Count 49
Funding $28,447,131.17
PubMed Score 55.49
PubTator Score 11.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.385 0.014
Multiple myeloma 1.426 0.001
oligodendroglioma 1.200 0.010
psoriasis 1.600 0.000
lung cancer 2.100 0.001
ovarian cancer 1.800 0.008
dermatomyositis 1.500 0.000

Synonym

Accession O43583 Q9H3U6 Q9UKZ0 DRP
Symbols DRP
DRP1
SMAP-3

Gene

Gene RIF (1)

PMID Text
17878526 both HuR and AUF1 bind to discrete regions of DENR/DRP mRNA and that AUF1 silencing increases DENR/DRP protein levels.

AA Sequence

MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV      1 - 70
ENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEID     71 - 140
LKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK                141 - 198
//

Text Mined References (26)

PMID Year Title
27239039 2016 De Novo Mutations in DENR Disrupt Neuronal Development and Link Congenital Neurological Disorders to Faulty mRNA Translation Re-initiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20713520 2010 Activities of Ligatin and MCT-1/DENR in eukaryotic translation initiation and ribosomal recycling.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
More...