Property Summary

NCBI Gene PubMed Count 17
PubMed Score 120.31
PubTator Score 11.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.500 2.2e-04
lung cancer 2.100 6.6e-04
Multiple myeloma 1.426 1.5e-03
oligodendroglioma 1.200 1.0e-02
ovarian cancer -1.100 5.3e-04
psoriasis 1.600 1.7e-04
Waldenstrons macroglobulinemia 1.385 1.4e-02

Gene RIF (3)

AA Sequence

MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTV      1 - 70
ENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEID     71 - 140
LKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK                141 - 198
//

Text Mined References (29)

PMID Year Title