Property Summary

NCBI Gene PubMed Count 30
Grant Count 48
R01 Count 27
Funding $7,299,094.77
PubMed Score 40.86
PubTator Score 27.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Rheumatoid Arthritis -1.100 0.036
astrocytic glioma -1.100 0.008
oligodendroglioma -1.200 0.009
psoriasis 2.000 0.000
osteosarcoma -1.817 0.000
glioblastoma -1.500 0.001
medulloblastoma -1.600 0.000
medulloblastoma, large-cell -1.300 0.032
primitive neuroectodermal tumor -1.500 0.003
Atopic dermatitis 1.300 0.000
tuberculosis 1.100 0.001
active ulcerative colitis 1.072 0.046
adult high grade glioma -1.100 0.003
pilocytic astrocytoma -1.300 0.000

Gene RIF (7)

PMID Text
23255434 The RBD region associates with the RGS domain region, producing an intramolecular interaction within RGS14 that enhances the GTPase activating function.
21880739 RGS14 can form complexes with GPCRs in cells that are dependent on Galpha(i/o) and these RGS14.Galpha(i1).GPCR complexes may be substrates for other signaling partners such as Ric-8A
20842066 RGS-14 may facilitate cognitive processing by modulating Cav1 channel-mediated intracellular divalent calcium ion Ca(2)+ transients.
20627871 Observational study of gene-disease association. (HuGE Navigator)
19878719 RGS14 serves as a novel scaffold to integrate GTP-Binding Protein alpha Subunit and Ras/Raf/MAPkinase signalling events through the action of its GL domain.
19636837 NMR 1H, 13C and 15N resonances of the RGS domain (residues 56-207)
15917656 We show that RGS14 is a component of mitotic asters formed in vitro from HeLa cell extracts and that depletion of RGS14 from cell extracts blocks aster formation.

AA Sequence

MPGKPKHLGVPNGRMVLAVSDGELSSTTGPQGQGEGRGSSLSIHSLPSGPSSPFPTEEQPVASWALSFER      1 - 70
LLQDPLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTQQLAQEARNIYQEFLSSQALSPVNIDRQA     71 - 140
WLGEEVLAEPRPDMFRAQQLQIFNLMKFDSYARFVKSPLYRECLLAEAEGRPLREPGSSRLGSPDATRKK    141 - 210
PKLKPGKSLPLGVEELGQLPPVEGPGGRPLRKSFRRELGGTANAALRRESQGSLNSSASLDLGFLAFVSS    211 - 280
KSESHRKSLGSTEGESESRPGKYCCVYLPDGTASLALARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNE    281 - 350
QALVLDQDCTVLADQEVRLENRITFELELTALERVVRISAKPTKRLQEALQPILEKHGLSPLEVVLHRPG    351 - 420
EKQPLDLGKLVSSVAAQRLVLDTLPGVKISKARDKSPCRSQGCPPRTQDKATHPPPASPSSLVKVPSSAT    421 - 490
GKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVLPEFLQLPAQGPSSEETPPQTKSAAQPIGGSLNS    491 - 560
TTDSAL                                                                    561 - 566
//

Text Mined References (36)

PMID Year Title
24068962 2013 Meta-analysis of genome-wide association studies identifies six new Loci for serum calcium concentrations.
23255434 2013 The Ras-binding domain region of RGS14 regulates its functional interactions with heterotrimeric G proteins.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22797727 2012 Meta-analysis identifies multiple loci associated with kidney function-related traits in east Asian populations.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22396660 2012 A genome-wide association study of nephrolithiasis in the Japanese population identifies novel susceptible Loci at 5q35.3, 7p14.3, and 13q14.1.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21880739 2011 G protein-coupled receptors and resistance to inhibitors of cholinesterase-8A (Ric-8A) both regulate the regulator of g protein signaling 14 RGS14·G?i1 complex in live cells.
21833088 2011 Genetic risk and a primary role for cell-mediated immune mechanisms in multiple sclerosis.
21115486 2011 Structural determinants of affinity enhancement between GoLoco motifs and G-protein alpha subunit mutants.
More...