Property Summary

NCBI Gene PubMed Count 105
Grant Count 347
R01 Count 208
Funding $64,035,656.94
PubMed Score 165.91
PubTator Score 381.85

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Synonym

Accession O43561 B7WPI0 C7C5T6 G5E9K3 O43919
Symbols LAT1
pp36

Gene

LAT

Gene RIF (60)

PMID Text
26936531 High expression of LAT1 and ASCT2 correlates with metastasis and invasion in esophageal squamous cell carcinoma.
26715756 IFT20 is required for the delivery of the intracellular pool of LAT to the immune synapse in naive primary T lymphocytes.
26271970 Data show that the palmitoylation mutation of linker for activation of T cells (LAT)attenuated the signal transduction induced by glycosylphosphatidylinositol-anchored CD59 antigen in T cells.
25907557 HSV-1-encoded Us3 protein interrupted TCR signaling and interleukin-2 production by inactivation of the linker for activation of T cells.
24673455 Patients with severe aplastic anemia had increased levels of LAT and disturbed Th1-Th2 balance.
24204825 LAT is a modulator of CD3zeta and ZAP-70 tyrosine phosphorylation.
24200054 mutation of palmitoylation site of LAT-EGFP attenuated the signal transduction of CD59 in T cells
24038088 findings show that L-type amino acid transporter 1 is a major transporter for essential amino acids into activated human T cells
23986795 HIV-1 Nef inhibits expression of the LAT protein and its recruitment to SLP76-containing microclusters (MCs)
23514740 A novel function and mechanism of TRAF6 action in the T cell receptor(TCR)-LAT signaling pathway indicates that LAT also plays an adapter role in TCR/CD28-induced activation of TRAF6.
More...

AA Sequence

MEEAILVPCVLGLLLLPILAMLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPWPPAYPPVTSY      1 - 70
PPLSQPDLLPIPRSPQPLGGSHRTPSSRRDSDGANSVASYENEGASGIRGAQAGWGVWGPSWTRLTPVSL     71 - 140
PPEPACEDADEDEDDYHNPGYLVVLPDSTPATSTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGESA    141 - 210
EASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN                      211 - 262
//

Text Mined References (110)

PMID Year Title
27242165 2016 Early onset combined immunodeficiency and autoimmunity in patients with loss-of-function mutation in LAT.
26936531 2016 Clinicopathological significance of LAT1 and ASCT2 in patients with surgically resected esophageal squamous cell carcinoma.
26715756 2016 IFT20 controls LAT recruitment to the immune synapse and T-cell activation in vivo.
26271970 2015 [Mutation of palmitoylation site of linker for activation of T cells inhibits signal transduction mediated by glycosyl phosphatidyl inositol-anchored CD59 in T cells].
25907557 2015 The Us3 Protein of Herpes Simplex Virus 1 Inhibits T Cell Signaling by Confining Linker for Activation of T Cells (LAT) Activation via TRAF6 Protein.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24673455 2014 Abnormalities of quantities and functions of linker for activations of T cells in severe aplastic anemia.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24642916 2014 Fine specificity and molecular competition in SLAM family receptor signalling.
More...