Property Summary

NCBI Gene PubMed Count 85
Grant Count 28
R01 Count 12
Funding $2,053,120.59
PubMed Score 51.46
PubTator Score 67.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
osteosarcoma -1.033 0.000
tuberculosis and treatment for 6 months -2.400 0.000
non-small cell lung cancer -1.093 0.000
interstitial cystitis 1.600 0.000
ovarian cancer -1.700 0.000
head and neck cancer 1.700 0.000

Gene RIF (72)

PMID Text
26448572 Serum LIGHT levels correlate with disease progression and severity in interstitial pneumonia patients with dermatomyositis.
26146063 proliferation and migration would be enhanced in Tca8113 cells with over-expressed TNFSF14
25789702 The tumor necrosis factor superfamily molecule LIGHT promotes keratinocyte activity and skin fibrosis.
25680454 LIGHT controls TSLP to drive pulmonary fibrosis.
25512551 regulation by NK cell licensing helps to safeguard against TNFSF14 production in response to healthy tissues.
25501580 LIGHT, via LTbetaR signaling, may contribute to exacerbation of airway neutrophilic inflammation through cytokine and chemokine production by bronchial epithelial cells.
25460501 LIGHT, a TNF superfamily member, is involved in T-cell homeostasis and erosive bone disease associated with rheumatoid arthritis.
25251281 The findings suggest a new molecular determinant of LIGHT-mediated pathogenic changes in human bronchial epithelial cells.
25087510 Crystal structures of LIGHT and the LIGHT:DcR3 complex reveal the structural basis for the DcR3-mediated neutralization of LIGHT.
24782592 TNFSF14 has an effect on the activation of basophils and eosinophils interacting with bronchial epithelial cells
More...

AA Sequence

MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVT      1 - 70
RLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGY     71 - 140
YYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLE    141 - 210
AGEKVVVRVLDERLVRLRDGTRSYFGAFMV                                            211 - 240
//

Text Mined References (87)

PMID Year Title
26977880 2016 Facilitating T Cell Infiltration in Tumor Microenvironment Overcomes Resistance to PD-L1 Blockade.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26448572 2015 Increased Serum LIGHT Levels Correlate with Disease Progression and Severity of Interstitial Pneumonia in Patients with Dermatomyositis: A Case Control Study.
26146063 2015 [The capacity of proliferation and migration is higher in Tca8113 cells with up-regulated TNFSF14 expression].
25789702 2015 The Tumor Necrosis Factor Superfamily Molecule LIGHT Promotes Keratinocyte Activity and Skin Fibrosis.
25680454 2015 Tumor necrosis factor superfamily 14 (LIGHT) controls thymic stromal lymphopoietin to drive pulmonary fibrosis.
25512551 2014 Licensed human natural killer cells aid dendritic cell maturation via TNFSF14/LIGHT.
25501580 2014 Lymphotoxin ? receptor signaling induces IL-8 production in human bronchial epithelial cells.
25460501 2014 LIGHT/TNFSF14 increases osteoclastogenesis and decreases osteoblastogenesis in multiple myeloma-bone disease.
25251281 2015 LIGHT is a crucial mediator of airway remodeling.
More...