Property Summary

NCBI Gene PubMed Count 87
PubMed Score 61.36
PubTator Score 67.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 0.0 3.0
Disease Target Count Z-score Confidence
Ocular hypertension 42 3.479 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
head and neck cancer 1.400 7.9e-05
interstitial cystitis 1.600 3.9e-04
malignant mesothelioma -1.400 6.3e-07
non-small cell lung cancer -1.093 3.8e-13
osteosarcoma -1.033 2.1e-05
ovarian cancer -1.700 6.2e-11
tuberculosis -2.300 3.6e-07

Protein-protein Interaction (9)

Gene RIF (74)

AA Sequence

MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVT      1 - 70
RLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGY     71 - 140
YYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLE    141 - 210
AGEKVVVRVLDERLVRLRDGTRSYFGAFMV                                            211 - 240
//

Text Mined References (89)

PMID Year Title