Property Summary

NCBI Gene PubMed Count 55
PubMed Score 284.55
PubTator Score 14.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.0e-03
Disease Target Count Z-score Confidence
Endometriosis 540 3.554 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.094 1.0e-03

Gene RIF (24)

AA Sequence

MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLP      1 - 70
SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV                         71 - 120
//

Text Mined References (55)

PMID Year Title