Property Summary

NCBI Gene PubMed Count 55
Grant Count 16
R01 Count 5
Funding $1,109,518.66
PubMed Score 276.79
PubTator Score 14.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Endometriosis 535 3.435 1.7
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.094 0.001

Gene RIF (24)

PMID Text
23287110 GnRHII expression correlated significantly with poor prognosis in breast cancer patients.
21239435 concluded that GnRHII stimulates PI3K/Akt pathway, and the phosphorylation of glycogen synthase kinase3beta, thereby enhancing the beta-catenin-dependent up-regulation of MT1-MMP production which contributes to ovarian cancer metastasis
21193558 results suggest GnRH-II-induced laminin receptor precursor expression increases 67-kDa nonintegrin laminin receptor, which appears to interact with laminin in the extracellular matrix to promote MMP-2 expression and enhance ovarian cancer cell invasion
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20018426 These preliminary data suggest that local GnRH-II may participate in the regulation of ovarian tumor growth in post-menopausal women.
19608641 These results provide evidence that EGF is an upstream regulator of the autocrine actions of GnRH-II on the invasive properties of ovarian cancer cells.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18599546 p-CREB, C/EBPbeta, and CBP are recruited to the CRE of the GnRH-II promoter in a temporarily defined manner to enhance its transcription in JEG-3 and OVCAR-3 cells in response to cAMP
More...

AA Sequence

MASSRRGLLLLLLLTAHLGPSEAQHWSHGWYPGGKRALSSAQDPQNALRPPGRALDTAAGSPVQTAHGLP      1 - 70
SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV                         71 - 120
//

Text Mined References (55)

PMID Year Title
25908176 2015 Comparative in vitro biological evaluation of daunorubicin containing GnRH-I and GnRH-II conjugates developed for tumor targeting.
25761596 2015 Gonadotropin-releasing hormone type II (GnRH-II) agonist regulates the motility of human decidual endometrial stromal cells: possible effect on embryo implantation and pregnancy.
25107740 2014 GnRH receptors and peptides: skating backward.
25030361 2014 Towards neuroimmunotherapy for cancer: the neurotransmitters glutamate, dopamine and GnRH-II augment substantially the ability of T cells of few head and neck cancer patients to perform spontaneous migration, chemotactic migration and migration towards the autologous tumor, and also elevate markedly the expression of CD3zeta and CD3epsilon TCR-associated chains.
24926857 2014 Apoptotic death of prostate cancer cells by a gonadotropin-releasing hormone-II antagonist.
24228111 2013 Effect of GnRH-II on the ESC proliferation, apoptosis and VEGF secretion in patients with endometriosis in vitro.
24103690 2013 Expression and distribution of GnRH, LH, and FSH and their receptors in gastrointestinal tract of man and rat.
23786715 2013 Gonadotropin-releasing hormone type II (GnRH-II) agonist regulates the invasiveness of endometrial cancer cells through the GnRH-I receptor and mitogen-activated protein kinase (MAPK)-dependent activation of matrix metalloproteinase (MMP)-2.
23287110 2013 Gonadotropin-releasing hormone neuropeptides and receptor in human breast cancer: correlation to poor prognosis parameters.
23154267 2013 Starving tumors: inhibition of glycolysis reduces viability of human endometrial and ovarian cancer cells and enhances antitumor efficacy of GnRH receptor-targeted therapies.
More...