Property Summary

NCBI Gene PubMed Count 23
PubMed Score 84.95
PubTator Score 34.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
cystic fibrosis -1.900 1.9e-04
medulloblastoma, large-cell 1.200 1.2e-04
pulmonary arterial hypertension -1.200 2.5e-02

Gene RIF (17)

AA Sequence

MAQGLEVALTDLQSSRNNVRHHTEEITVDHLLVRRGQAFNLTLYFRNRSFQPGLDNIIFVVETGPLPDLA      1 - 70
LGTRAVFSLARHHSPSPWIAWLETNGATSTEVSLCAPPTAAVGRYLLKIHIDSFQGSVTAYQLGEFILLF     71 - 140
NPWCPEDAVYLDSEPQRQEYVMNDYGFIYQGSKNWIRPCPWNYGQFEDKIIDICLKLLDKSLHFQTDPAT    141 - 210
DCALRGSPVYVSRVVCAMINSNDDNGVLNGNWSENYTDGANPAEWTGSVAILKQWNATGCQPVRYGQCWV    211 - 280
FAAVMCTVMRCLGIPTRVITNFDSGHDTDGNLIIDEYYDNTGRILGNKKKDTIWNFHVWNECWMARKDLP    281 - 350
PAYGGWQVLDATPQEMSNGVYCCGPASVRAIKEGEVDLNYDTPFVFSMVNADCMSWLVQGGKEQKLHQDT    351 - 420
SSVGNFISTKSIQSDERDDITENYKYEEGSLQERQVFLKALQKLKARSFHGSQRGAELQPSRPTSLSQDS    421 - 490
PRSLHTPSLRPSDVVQVSLKFKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQ    491 - 560
DTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKILVNKIITLSYPSITINVLGAA    561 - 630
VVNQPLSIQVIFSNPLSEQVEDCVLTVEGSGLFKKQQKVFLGVLKPQHQASIILETVPFKSGQRQIQANM    631 - 700
RSNKFKDIKGYRNVYVDFAL                                                      701 - 720
//

Text Mined References (22)

PMID Year Title