Property Summary

NCBI Gene PubMed Count 120
Grant Count 136
R01 Count 94
Funding $12,328,190.13
PubMed Score 465.86
PubTator Score 103.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.500 0.009
ependymoma 1.400 0.020
oligodendroglioma 1.400 0.010
lung adenocarcinoma 1.300 0.000
non-small cell lung carcinoma 1.500 0.000
ovarian cancer -2.700 0.000

Synonym

Accession O43543 B2R925
Symbols FANCU

Gene

Gene RIF (103)

PMID Text
26801223 Results indicate that homologous recombination repair genes XRCC2 Arg188His and XRCC3 Thr241Met polymorphisms may be positively associated with the incidence of ovarian carcinoma in the population of Polish women.
26400309 The XRCC2 Arg188His polymorphism was associated with the risk of ovarian cancer. (Meta-analysis)
26339569 The aim of the present study was to evaluate the relationship between prostate cancer risk and the presence of single nucleotide polymorphisms in the genes involved in Homologous recombination repair, RAD51, RAD51B, XRCC2 and XRCC3.
26320178 Suggest that XRCC2 is a useful predictive biomarker of preoperative radiotherapy treatment response in locally advanced rectal cancer patients.
26017882 Links the SNP -41657C/T (rs718282) of the XRCC2 gene with endometrial carcinoma in Polish women.
25556451 The GA genotype of the Arg188His polymorphism of XRCC2 was associated with increased risk of breast cancer in a Pakistani cohort.
25526472 High XRCC2 expression promotes CRC cell proliferation and enriches cells in the G0/G1 phase but inhibits apoptosis.
25428673 Single nucleotide changes were studied in XRCC2 and XRCC3 genes at locus Arg188His and Thr241Met in stomach cancer patients who lived in North Eastern Turkey and in controls.
25355640 A relationship was identified between XRCC2-41657C/T polymorphism and the incidence of ovarian cancer.
25304007 XRCC2 protein expression of colorectal cancer Chinese Han patients with CT/TT genotypes were significantly higher than CC genotype.
More...

AA Sequence

MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS      1 - 70
EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH     71 - 140
PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS    141 - 210
HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC    211 - 280
//

Text Mined References (123)

PMID Year Title
27208205 2016 Complementation of hypersensitivity to DNA interstrand crosslinking agents demonstrates that XRCC2 is a Fanconi anaemia gene.
26801223 2016 Association between single nucleotide polymorphisms (SNPs) of XRCC2 and XRCC3 homologous recombination repair genes and ovarian cancer in Polish women.
26400309 2015 Arg188His polymorphism in the XRCC2 gene and the risk of ovarian cancer: a meta-analysis.
26339569 2015 Polymorphisms of homologous recombination RAD51, RAD51B, XRCC2, and XRCC3 genes and the risk of prostate cancer.
26320178 2015 XRCC2 as a predictive biomarker for radioresistance in locally advanced rectal cancer patients undergoing preoperative radiotherapy.
26017882 2015 Association between -41657C/T single nucleotide polymorphism of DNA repair gene XRCC2 and endometrial cancer risk in Polish women.
25556451 2014 Correlation between selected XRCC2, XRCC3 and RAD51 gene polymorphisms and primary breast cancer in women in Pakistan.
25526472 2014 XRCC2 promotes colorectal cancer cell growth, regulates cell cycle progression, and apoptosis.
25428673 2014 Polymorphisms in DNA repair genes XRCC2 and XRCC3 risk of gastric cancer in Turkey.
25416956 2014 A proteome-scale map of the human interactome network.
More...