Property Summary

NCBI Gene PubMed Count 126
PubMed Score 492.93
PubTator Score 103.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
FANCONI ANEMIA, COMPLEMENTATION GROUP U 1 0.0 0.0
Disease Target Count P-value
non-small cell lung carcinoma 317 1.2e-24
lung adenocarcinoma 2716 5.2e-08
ovarian cancer 8520 3.3e-06
astrocytic glioma 2597 9.1e-03
oligodendroglioma 2850 1.0e-02
ependymoma 4679 2.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Breast cancer 3578 6.234 3.1
Disease Target Count
Fanconi anemia 56

Expression

  Differential Expression (6)

Disease log2 FC p
ovarian cancer -2.700 3.3e-06
astrocytic glioma 1.500 9.1e-03
ependymoma 1.400 2.0e-02
lung adenocarcinoma 1.100 5.2e-08
non-small cell lung carcinoma 1.500 1.2e-24
oligodendroglioma 1.400 1.0e-02

Protein-protein Interaction (3)

Gene RIF (108)

AA Sequence

MCSAFHRAESGTELLARLEGRSSLKEIEPNLFADEDSPVHGDILEFHGPEGTGKTEMLYHLTARCILPKS      1 - 70
EGGLEVEVLFIDTDYHFDMLRLVTILEHRLSQSSEEIIKYCLGRFFLVYCSSSTHLLLTLYSLESMFCSH     71 - 140
PSLCLLILDSLSAFYWIDRVNGGESVNLQESTLRKCSQCLEKLVNDYRLVLFATTQTIMQKASSSSEEPS    141 - 210
HASRRLCDVDIDYRPYLCKAWQQLVKHRMFFSKQDDSQSSNQFSLVSRCLKSNSLKKHFFIIGESGVEFC    211 - 280
//

Text Mined References (129)

PMID Year Title