Property Summary

NCBI Gene PubMed Count 432
Grant Count 97
R01 Count 76
Funding $4,489,152.39
PubMed Score 286.40
PubTator Score 412.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.054 0.000
medulloblastoma, large-cell 1.100 0.001

Synonym

Accession O43542 O43568 Q9BU18
Symbols CMM6

Gene

Gene RIF (459)

PMID Text
26898429 The aim of this study was to investigate the association between polymorphisms of XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln and laryngeal cancer risk.
26881229 the results obtained during this study suggest that rs1799794 in XRCC3 shows strong association with breast cancer development in Saudi females.
26801223 Results indicate that homologous recombination repair genes XRCC2 Arg188His and XRCC3 Thr241Met polymorphisms may be positively associated with the incidence of ovarian carcinoma in the population of Polish women.
26687776 XRCC3 Thr241Met polymorphism is associated with an increased risk of thyroid cancer in the overall population
26662447 our study firstly reports that XRCC3 Thr241Met gene polymorphism is associated with an elavated risk of osteosarcoma.
26662391 XRCC3 T241M polymorphism may constitute a risk factor for hepatocellular carcinoma in the Chinese population (Meta-Analysis)
26617908 XRCC3 Thr241Met gene polymorphism was associated with increased risk of osteosarcoma
26600544 Our findings demonstrated that the T241M polymorphism in the XRCC3 gene may not be a risk factor for colorectal cancer development.
26543082 XRCC3 rs861539 TT is a potential predictive marker for triple-negative breast cancer in Taiwanese women
26498491 XRCC3 Thr241Met polymorphism might be associated with breast cancer risk, especially in Asian populations and in patients without family history of breast ca [meta-analysis]
More...

AA Sequence

MDLDLLDLNPRIIAAIKKAKLKSVKEVLHFSGPDLKRLTNLSSPEVWHLLRTASLHLRGSSILTALQLHQ      1 - 70
QKERFPTQHQRLSLGCPVLDALLRGGLPLDGITELAGRSSAGKTQLALQLCLAVQFPRQHGGLEAGAVYI     71 - 140
CTEDAFPHKRLQQLMAQQPRLRTDVPGELLQKLRFGSQIFIEHVADVDTLLECVNKKVPVLLSRGMARLV    141 - 210
VIDSVAAPFRCEFDSQASAPRARHLQSLGATLRELSSAFQSPVLCINQVTEAMEEQGAAHGPLGFWDERV    211 - 280
SPALGITWANQLLVRLLADRLREEEAALGCPARTLRVLSAPHLPPSSCSYTISAEGVRGTPGTQSH        281 - 346
//

Text Mined References (436)

PMID Year Title
26898429 2016 Single nucleotide polymorphisms in DNA repair genes and the risk of laryngeal cancer: A meta-analysis.
26881229 2016 Polymorphisms in DNA Repair Gene XRCC3 and Susceptibility to Breast Cancer in Saudi Females.
26801223 2016 Association between single nucleotide polymorphisms (SNPs) of XRCC2 and XRCC3 homologous recombination repair genes and ovarian cancer in Polish women.
26687776 2015 Association Between X-Ray Cross-complementing Group 3 (XRCC3) Thr241Met Polymorphism and Risk of Thyroid Cancer: A Meta-Analysis.
26662447 2015 Association between XRCC3 Thr241Met polymorphism and risk of osteosarcoma in a Chinese population.
26662391 2015 DNA repair gene XRCC3 T241M polymorphism and susceptibility to hepatocellular carcinoma in a Chinese population: a meta-analysis.
26617908 2015 Association between XRCC3 Thr241Met polymorphism and risk of osteosarcoma in a Chinese population.
26600544 2015 Meta-analysis of the relationship between XRCC3 T241M polymorphism and colorectal cancer susceptibility.
26543082 Contribution of DNA Double-strand Break Repair Gene XRCC3 Genotypes to Triple-negative Breast Cancer Risk.
26498491 2015 Association between XRCC3 Thr241Met Polymorphism and Risk of Breast Cancer: Meta-Analysis of 23 Case-Control Studies.
More...