Property Summary

NCBI Gene PubMed Count 64
PubMed Score 106.73
PubTator Score 59.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
colon cancer 1.500 1.2e-03
cystic fibrosis -1.200 2.8e-03
ductal carcinoma in situ -1.200 3.7e-03
group 4 medulloblastoma -1.900 5.5e-06
intraductal papillary-mucinous neoplasm ... 1.800 8.1e-03
invasive ductal carcinoma -1.300 2.2e-02
lung adenocarcinoma -1.200 1.7e-13
lung carcinoma -1.700 1.6e-08
malignant mesothelioma -1.200 1.7e-06
medulloblastoma, large-cell -1.500 3.3e-04
non-small cell lung cancer -2.321 7.7e-20
osteosarcoma 1.589 2.6e-02
psoriasis 1.300 8.9e-03

Gene RIF (42)

AA Sequence

MFRSKRSGLVRRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEVRPVAPRRPRD      1 - 70
AVGQRGAQGAGRRRRAGGPPRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLFSERDAAGAPRD     71 - 140
ASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKERSLDTLLEAVESRGGVPGGCVLVPR    141 - 210
ADLRLGGQPAPPQLLLGRLFRWPDLQHAVELKPLCGCHSFAAAADGPTVCCNPYHFSRLCGPESPPPPYS    211 - 280
RLSPRDEYKPLDLSDSTLSYTETEATNSLITAPGEFSDASMSPDATKPSHWCSVAYWEHRTRVGRLYAVY    281 - 350
DQAVSIFYDLPQGSGFCLGQLNLEQRSESVRRTRSKIGFGILLSKEPDGVWAYNRGEHPIFVNSPTLDAP    351 - 420
GGRALVVRKVPPGYSIKVFDFERSGLQHAPEPDAADGPYDPNSVRISFAKGWGPCYSRQFITSCPCWLEI    421 - 490
LLNNPR                                                                    491 - 496
//

Text Mined References (65)

PMID Year Title