Property Summary

Ligand Count 8
NCBI Gene PubMed Count 81
PubMed Score 103.94
PubTator Score 105.97

Knowledge Summary

Patent (10,723)


  Disease (8)

Disease Target Count Z-score Confidence
Seizures, Benign Familial Neonatal, 2 2 0.0 0.0
Disease Target Count Z-score Confidence
Benign neonatal seizures 4 0.0 5.0


  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.500 5.0e-03
astrocytic glioma -1.700 1.4e-03
Astrocytoma, Pilocytic -1.700 1.8e-05
atypical teratoid / rhabdoid tumor -2.800 7.7e-09
ependymoma -2.300 7.8e-04
glioblastoma -1.600 3.8e-06
group 4 medulloblastoma -2.900 8.0e-06
malignant mesothelioma -1.300 3.0e-06
medulloblastoma, large-cell -2.100 1.7e-03
oligodendroglioma -1.700 7.1e-03
ovarian cancer 1.100 7.5e-12
Pick disease -1.200 4.4e-02
primitive neuroectodermal tumor -1.800 1.2e-03

Gene RIF (44)

AA Sequence

DTDPFTPSGSMPLSSTGDGISDSVWTPSNKPI                                          841 - 872

Text Mined References (83)

PMID Year Title