Property Summary

NCBI Gene PubMed Count 398
Grant Count 474
R01 Count 299
Funding $43,537,208.19
PubMed Score 758.91
PubTator Score 594.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -2.906 0.000
astrocytoma 1.500 0.004
acute quadriplegic myopathy 1.170 0.010
intraductal papillary-mucinous neoplasm ... -1.400 0.001
spina bifida -1.155 0.037
ovarian cancer -2.100 0.000
chronic rhinosinusitis -1.243 0.007
cystic fibrosis and chronic rhinosinusit... -1.044 0.020
dermatomyositis 1.700 0.004

Synonym

Accession O43524 B4DVZ6 E1P5E6 O15171 Q5T2I7 Q9BZ04
Symbols FOXO2
AF6q21
FKHRL1
FOXO3A
FKHRL1P2

Gene

PDB

2K86   2LQH   2LQI   2UZK  

Gene RIF (382)

PMID Text
27529982 FOXO1A gene polymorphic site rs4943794 is associated with an acquisition of old and senescent age and with women's longevity. FOXO3A gene polymorphic site rs3800231 is associated with longevity in both women and men.
26874277 This shows that Pin1 is implemented in maintaining the susceptibility to the genotoxic drugs by controlling P-gp level as well as p53-dependent apoptosis and cell cycle signaling pathways.
26861625 Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.
26826001 overexpression of the IGF-1R, and activation of GSK3beta and FOXO3a might be the molecular mechanisms underlying the development of liver cirrhosis
26740175 Taken together, these results show that CHAF1A contributes to the proliferation of glioblastoma cells and may be developed as a de novo drug target and prognosis biomarker of glioblastoma.
26683100 Data show one single nucleotide polymorphism (SNP) in Fox transcription factor FOXO3 (FOXO3) was significantly associated with longevity, and the six SNPs in proto-oncogene protein AKT1 (AKT1) gene and in IGF-2 Receptor (IGF-2R) gene are not.
26682007 this study demonstrated that JC induced the apoptosis of hepatocellular carcinoma (HCC) cells by activating Akt/Foxo signaling pathway and increasing intracellular ROS levels.
26657850 EGF stimulates loss of FOXO3/SIRT6, which is blockaded by the inhibition of upstream pathways as well as lipid synthesis, revealing existence of a negative regulatory loop between LDs and FOXO3/SIRT6.
26643256 Forkhead Box Transcription Factor (FOXO3a) mediates the cytotoxic effect of vernodalin in vitro and inhibits the breast tumor growth in vivo
26590814 FOXO3a mRNA expression levels in breast cancer patients correlated with metastasis-free survival.
More...

AA Sequence

MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG      1 - 70
GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA     71 - 140
AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI    141 - 210
RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES    211 - 280
ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS    281 - 350
SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG    351 - 420
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD    421 - 490
PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS    491 - 560
ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS    561 - 630
ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG                               631 - 673
//

Text Mined References (406)

PMID Year Title
27529982 2016 [Analysis of FOXO1A and FOXO3A Gene Allele Association with Human Longevity].
26874277 2016 Prolyl isomerase Pin1 regulates doxorubicin-inducible P-glycoprotein level by reducing Foxo3 stability.
26861625 2016 Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2.
26826001 2016 Hepatic IGF-1R overexpression combined with the activation of GSK-3? and FOXO3a in the development of liver cirrhosis.
26740175 2016 Over-expression of CHAF1A promotes cell proliferation and apoptosis resistance in glioblastoma cells via AKT/FOXO3a/Bim pathway.
26683100 2016 Association study of polymorphisms in FOXO3, AKT1 and IGF-2R genes with human longevity in a Han Chinese population.
26682007 2016 Juglanthraquinone C Induces Intracellular ROS Increase and Apoptosis by Activating the Akt/Foxo Signal Pathway in HCC Cells.
26657850 2016 Epidermal growth factor receptor mediated proliferation depends on increased lipid droplet density regulated via a negative regulatory loop with FOXO3/Sirtuin6.
26643256 2015 Forkhead Box Transcription Factor (FOXO3a) mediates the cytotoxic effect of vernodalin in vitro and inhibits the breast tumor growth in vivo.
26590814 2015 Simvastatin prevents triple-negative breast cancer metastasis in pre-clinical models through regulation of FOXO3a.
More...