Property Summary

NCBI Gene PubMed Count 478
PubMed Score 863.90
PubTator Score 594.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
acute quadriplegic myopathy 1.170 1.0e-02
astrocytoma 1.500 4.1e-03
chronic rhinosinusitis -1.243 6.7e-03
cystic fibrosis and chronic rhinosinusit... -1.044 2.0e-02
dermatomyositis 1.700 4.1e-03
intraductal papillary-mucinous neoplasm ... -1.400 1.3e-03
osteosarcoma -2.906 3.2e-06
ovarian cancer -2.100 4.5e-12
psoriasis -1.600 5.2e-05
spina bifida -1.155 3.7e-02

Gene RIF (460)

AA Sequence

MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG      1 - 70
GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA     71 - 140
AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI    141 - 210
RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES    211 - 280
ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS    281 - 350
SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG    351 - 420
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD    421 - 490
PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS    491 - 560
ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS    561 - 630
ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG                               631 - 673
//

Text Mined References (486)

PMID Year Title