Tbio | Forkhead box protein O3 |
Transcriptional activator which triggers apoptosis in the absence of survival factors, including neuronal cell death upon oxidative stress. Recognizes and binds to the DNA sequence 5'-[AG]TAAA[TC]A-3'. Participates in post-transcriptional regulation of MYC: following phosphorylation by MAPKAPK5, promotes induction of miR-34b and miR-34c expression, 2 post-transcriptional regulators of MYC that bind to the 3'UTR of MYC transcript and prevent its translation.
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
ovarian cancer | 8492 | 4.48918404004797E-12 |
osteosarcoma | 7933 | 3.17553436334752E-6 |
psoriasis | 6685 | 5.21317762904738E-5 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00126194980267963 |
astrocytoma | 1493 | 0.00405800403423393 |
dermatomyositis | 967 | 0.00411417109005707 |
chronic rhinosinusitis | 512 | 0.00669768328619352 |
acute quadriplegic myopathy | 1157 | 0.0102759332038565 |
cystic fibrosis and chronic rhinosinusitis | 213 | 0.02009435126925 |
spina bifida | 1064 | 0.0368869036225827 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Muscular atrophy | 67 | 3.96 | 2.0 |
Premature ovarian failure | 64 | 3.835 | 1.9 |
diabetes mellitus | 1663 | 3.359 | 1.7 |
Vascular disease | 281 | 3.328 | 1.7 |
Disease | log2 FC | p |
---|---|---|
psoriasis | -1.600 | 0.000 |
osteosarcoma | -2.906 | 0.000 |
astrocytoma | 1.500 | 0.004 |
acute quadriplegic myopathy | 1.170 | 0.010 |
intraductal papillary-mucinous neoplasm ... | -1.400 | 0.001 |
spina bifida | -1.155 | 0.037 |
ovarian cancer | -2.100 | 0.000 |
chronic rhinosinusitis | -1.243 | 0.007 |
cystic fibrosis and chronic rhinosinusit... | -1.044 | 0.020 |
dermatomyositis | 1.700 | 0.004 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Horse | OMA EggNOG |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Zebrafish | OMA EggNOG |
PMID | Text |
---|---|
27529982 | FOXO1A gene polymorphic site rs4943794 is associated with an acquisition of old and senescent age and with women's longevity. FOXO3A gene polymorphic site rs3800231 is associated with longevity in both women and men. |
26874277 | This shows that Pin1 is implemented in maintaining the susceptibility to the genotoxic drugs by controlling P-gp level as well as p53-dependent apoptosis and cell cycle signaling pathways. |
26861625 | Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2. |
26826001 | overexpression of the IGF-1R, and activation of GSK3beta and FOXO3a might be the molecular mechanisms underlying the development of liver cirrhosis |
26740175 | Taken together, these results show that CHAF1A contributes to the proliferation of glioblastoma cells and may be developed as a de novo drug target and prognosis biomarker of glioblastoma. |
26683100 | Data show one single nucleotide polymorphism (SNP) in Fox transcription factor FOXO3 (FOXO3) was significantly associated with longevity, and the six SNPs in proto-oncogene protein AKT1 (AKT1) gene and in IGF-2 Receptor (IGF-2R) gene are not. |
26682007 | this study demonstrated that JC induced the apoptosis of hepatocellular carcinoma (HCC) cells by activating Akt/Foxo signaling pathway and increasing intracellular ROS levels. |
26657850 | EGF stimulates loss of FOXO3/SIRT6, which is blockaded by the inhibition of upstream pathways as well as lipid synthesis, revealing existence of a negative regulatory loop between LDs and FOXO3/SIRT6. |
26643256 | Forkhead Box Transcription Factor (FOXO3a) mediates the cytotoxic effect of vernodalin in vitro and inhibits the breast tumor growth in vivo |
26590814 | FOXO3a mRNA expression levels in breast cancer patients correlated with metastasis-free survival. |
More... |
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEEDDEDDEDGG 1 - 70 GRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGA 71 - 140 AGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSI 141 - 210 RHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPES 211 - 280 ADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSS 281 - 350 SASLSPSVSKPCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG 351 - 420 SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSHSDVMMTQSD 421 - 490 PLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLS 491 - 560 ESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPVMGHEKFPSDLDLDMFNGSLECDMESIIRS 561 - 630 ELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG 631 - 673 //
PMID | Year | Title |
---|---|---|
27529982 | 2016 | [Analysis of FOXO1A and FOXO3A Gene Allele Association with Human Longevity]. |
26874277 | 2016 | Prolyl isomerase Pin1 regulates doxorubicin-inducible P-glycoprotein level by reducing Foxo3 stability. |
26861625 | 2016 | Foxo3 circular RNA retards cell cycle progression via forming ternary complexes with p21 and CDK2. |
26826001 | 2016 | Hepatic IGF-1R overexpression combined with the activation of GSK-3? and FOXO3a in the development of liver cirrhosis. |
26740175 | 2016 | Over-expression of CHAF1A promotes cell proliferation and apoptosis resistance in glioblastoma cells via AKT/FOXO3a/Bim pathway. |
26683100 | 2016 | Association study of polymorphisms in FOXO3, AKT1 and IGF-2R genes with human longevity in a Han Chinese population. |
26682007 | 2016 | Juglanthraquinone C Induces Intracellular ROS Increase and Apoptosis by Activating the Akt/Foxo Signal Pathway in HCC Cells. |
26657850 | 2016 | Epidermal growth factor receptor mediated proliferation depends on increased lipid droplet density regulated via a negative regulatory loop with FOXO3/Sirtuin6. |
26643256 | 2015 | Forkhead Box Transcription Factor (FOXO3a) mediates the cytotoxic effect of vernodalin in vitro and inhibits the breast tumor growth in vivo. |
26590814 | 2015 | Simvastatin prevents triple-negative breast cancer metastasis in pre-clinical models through regulation of FOXO3a. |
More... |