Property Summary

NCBI Gene PubMed Count 64
PubMed Score 273.01
PubTator Score 189.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Cholestasis 155 6.752 3.4
Liver disease 237 5.5 2.8
ARC syndrome 13 3.093 1.5

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma 2.900 4.4e-03
dermatomyositis 1.200 2.3e-02
ductal carcinoma in situ 1.600 6.7e-04
ependymoma 3.100 5.2e-03
esophageal adenocarcinoma 1.700 1.8e-02
group 4 medulloblastoma -1.400 2.4e-02
interstitial cystitis -2.100 6.1e-04
intraductal papillary-mucinous adenoma (... 2.800 3.5e-05
intraductal papillary-mucinous carcinoma... 2.600 9.6e-04
intraductal papillary-mucinous neoplasm ... 2.200 2.3e-03
invasive ductal carcinoma 1.400 1.2e-02
medulloblastoma, large-cell -1.700 1.1e-02
oligodendroglioma 2.900 3.2e-03
osteosarcoma 1.010 2.7e-02
ovarian cancer -1.900 3.2e-05
pancreatic ductal adenocarcinoma liver m... 2.801 5.9e-04
Pick disease 1.300 3.5e-06
pituitary cancer -1.300 4.5e-03
spina bifida -2.085 4.0e-02

Gene RIF (40)

AA Sequence

MSTERDSETTFDEDSQPNDEVVPYSDDETEDELDDQGSAVEPEQNRVNREAEENREPFRKECTWQVKAND      1 - 70
RKYHEQPHFMNTKFLCIKESKYANNAIKTYKYNAFTFIPMNLFEQFKRAANLYFLALLILQAVPQISTLA     71 - 140
WYTTLVPLLVVLGVTAIKDLVDDVARHKMDKEINNRTCEVIKDGRFKVAKWKEIQVGDVIRLKKNDFVPA    141 - 210
DILLLSSSEPNSLCYVETAELDGETNLKFKMSLEITDQYLQREDTLATFDGFIECEEPNNRLDKFTGTLF    211 - 280
WRNTSFPLDADKILLRGCVIRNTDFCHGLVIFAGADTKIMKNSGKTRFKRTKIDYLMNYMVYTIFVVLIL    281 - 350
LSAGLAIGHAYWEAQVGNSSWYLYDGEDDTPSYRGFLIFWGYIIVLNTMVPISLYVSVEVIRLGQSHFIN    351 - 420
WDLQMYYAEKDTPAKARTTTLNEQLGQIHYIFSDKTGTLTQNIMTFKKCCINGQIYGDHRDASQHNHNKI    421 - 490
EQVDFSWNTYADGKLAFYDHYLIEQIQSGKEPEVRQFFFLLAVCHTVMVDRTDGQLNYQAASPDEGALVN    491 - 560
AARNFGFAFLARTQNTITISELGTERTYNVLAILDFNSDRKRMSIIVRTPEGNIKLYCKGADTVIYERLH    561 - 630
RMNPTKQETQDALDIFANETLRTLCLCYKEIEEKEFTEWNKKFMAASVASTNRDEALDKVYEEIEKDLIL    631 - 700
LGATAIEDKLQDGVPETISKLAKADIKIWVLTGDKKETAENIGFACELLTEDTTICYGEDINSLLHARME    701 - 770
NQRNRGGVYAKFAPPVQESFFPPGGNRALIITGSWLNEILLEKKTKRNKILKLKFPRTEEERRMRTQSKR    771 - 840
RLEAKKEQRQKNFVDLACECSAVICCRVTPKQKAMVVDLVKRYKKAITLAIGDGANDVNMIKTAHIGVGI    841 - 910
SGQEGMQAVMSSDYSFAQFRYLQRLLLVHGRWSYIRMCKFLRYFFYKNFAFTLVHFWYSFFNGYSAQTAY    911 - 980
EDWFITLYNVLYTSLPVLLMGLLDQDVSDKLSLRFPGLYIVGQRDLLFNYKRFFVSLLHGVLTSMILFFI    981 - 1050
PLGAYLQTVGQDGEAPSDYQSFAVTIASALVITVNFQIGLDTSYWTFVNAFSIFGSIALYFGIMFDFHSA   1051 - 1120
GIHVLFPSAFQFTGTASNALRQPYIWLTIILAVAVCLLPVVAIRFLSMTIWPSESDKIQKHRKRLKAEEQ   1121 - 1190
WQRRQQVFRRGVSTRRSAYAFSHQRGYADLISSGRSIRKKRSPLDAIVADGTAEYRRTGDS            1191 - 1251
//

Text Mined References (67)

PMID Year Title