Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $1,276,446
PubMed Score 10.22
PubTator Score 7.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
osteosarcoma 7,933
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma -1.783 0.000

Synonym

Accession O43513 hMED7
Symbols ARC34
CRSP9
CRSP33

Gene

Gene RIF (6)

PMID Text
25100719 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18976975 Knockdown of MED7 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18854154 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18187620 Knockdown of MED7 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18187620 Knockdown of mediator complex subunit 7 (MED7) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM      1 - 70
QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME     71 - 140
VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH    141 - 210
RRDQIIEKDAALCVLIDEMNERP                                                   211 - 233
//

Text Mined References (25)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
21729782 2011 Human mediator subunit MED26 functions as a docking site for transcription elongation factors.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18391015 2008 MED1 phosphorylation promotes its association with mediator: implications for nuclear receptor signaling.
17709345 2007 Ubc9 fusion-directed SUMOylation identifies constitutive and inducible SUMOylation.
More...