Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.21
PubTator Score 7.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.4e-04
psoriasis 6694 1.4e-03

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.783 2.4e-04
psoriasis -1.300 1.4e-03

Gene RIF (6)

AA Sequence

MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPM      1 - 70
QFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMME     71 - 140
VQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGH    141 - 210
RRDQIIEKDAALCVLIDEMNERP                                                   211 - 233
//

Text Mined References (27)

PMID Year Title