Property Summary

NCBI Gene PubMed Count 246
PubMed Score 501.33
PubTator Score 424.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.7
Disease Target Count Z-score Confidence
Autoimmune thyroiditis 27 0.0 5.0
Congenital hypothyroidism 26 0.0 5.0
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 6.916 3.5

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -1.100 5.4e-25
atypical teratoid / rhabdoid tumor -2.200 2.3e-08
chronic rhinosinusitis 2.736 1.1e-02
cystic fibrosis and chronic rhinosinusit... 3.707 2.1e-04
Endometriosis 1.254 4.5e-02
ependymoma -1.200 1.8e-06
glioblastoma -2.100 2.1e-05
group 4 medulloblastoma -1.400 1.6e-02
head and neck cancer and chronic obstruc... 1.900 7.0e-03
medulloblastoma, large-cell -2.400 1.5e-03
non-small cell lung cancer 2.600 3.5e-03
oligodendroglioma -1.100 2.5e-15
pediatric high grade glioma -1.100 6.3e-03
primitive neuroectodermal tumor -1.900 1.0e-02
psoriasis 2.200 9.4e-61
ulcerative colitis 1.600 4.4e-02

Gene RIF (229)

AA Sequence

MAAPGGRSEPPQLPEYSCSYMVSRPVYSELAFQQQHERRLQERKTLRESLAKCCSCSRKRAFGVLKTLVP      1 - 70
ILEWLPKYRVKEWLLSDVISGVSTGLVATLQGMAYALLAAVPVGYGLYSAFFPILTYFIFGTSRHISVGP     71 - 140
FPVVSLMVGSVVLSMAPDEHFLVSSSNGTVLNTTMIDTAARDTARVLIASALTLLVGIIQLIFGGLQIGF    141 - 210
IVRYLADPLVGGFTTAAAFQVLVSQLKIVLNVSTKNYNGVLSIIYTLVEIFQNIGDTNLADFTAGLLTIV    211 - 280
VCMAVKELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFLPPELPPVSLFSEML    281 - 350
AASFSIAVVAYAIAVSVGKVYATKYDYTIDGNQEFIAFGISNIFSGFFSCFVATTALSRTAVQESTGGKT    351 - 420
QVAGIISAAIVMIAILALGKLLEPLQKSVLAAVVIANLKGMFMQLCDIPRLWRQNKIDAVIWVFTCIVSI    421 - 490
ILGLDLGLLAGLIFGLLTVVLRVQFPSWNGLGSIPSTDIYKSTKNYKNIEEPQGVKILRFSSPIFYGNVD    491 - 560
GFKKCIKSTVGFDAIRVYNKRLKALRKIQKLIKSGQLRATKNGIISDAVSTNNAFEPDEDIEDLEELDIP    561 - 630
TKEIEIQVDWNSELPVKVNVPKVPIHSLVLDCGAISFLDVVGVRSLRVIVKEFQRIDVNVYFASLQDYVI    631 - 700
EKLEQCGFFDDNIRKDTFFLTVHDAILYLQNQVKSQEGQGSILETITLIQDCKDTLELIETELTEEELDV    701 - 770
QDEAMRTLAS                                                                771 - 780
//

Text Mined References (250)

PMID Year Title