Property Summary

NCBI Gene PubMed Count 168
PubMed Score 362.72
PubTator Score 276.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (157)

AA Sequence

MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSE      1 - 70
LNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINS     71 - 140
SSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLC    141 - 210
QVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH                                   211 - 249
//

Text Mined References (171)

PMID Year Title