Property Summary

NCBI Gene PubMed Count 145
PubMed Score 337.40
PubTator Score 276.43

Knowledge Summary


No data available



Accession O43508 Q8IZK7 Q8WUZ7
Symbols APO3L




  Ortholog (3)

Species Source
Chimp OMA Inparanoid
Mouse OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (134)

27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26808775 These findings suggest that TWEAK signaling might be an aspect of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine -mediated neuropathology and be involved in the overall neurodegenerative pathology of Parkinson's disease
26658801 HIV-associated lipodystrophy syndrome is associated with decreased serum TWEAK levels.
26499979 Data indicate that serum levels of tumour necrosis factor (TNF)-like weak inducer of apoptosis (TWEAK) were significantly higher in psoriasis patients compared to controls.
26224570 TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages.
26016896 HPV16 infection keratinocytes causes switch of apoptosis to proliferative phase under TWEAK interaction..
25890309 Suggest that the pro-inflammatory cytokine TWEAK and TGF-beta1 have synergistic effects in EMT and may contribute to chronic airway changes and remodeling.
25776497 This review describes the interactions between Tweak and Fn14 and how they play critical roles in osteoclast differentiation.
25681674 Diminished sTWEAK concentrations are significantly and independently associated with the presence of carotid atherosclerotic plaques in asymptomatic subjects
25622756 TWEAK induces noncanonical NF-kappaB signaling and signal-specific regulation of NIK mRNA expression.

AA Sequence

QVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH                                   211 - 249

Text Mined References (148)

PMID Year Title
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26808775 2016 The role of TWEAK/Fn14 signaling in the MPTP-model of Parkinson's disease.
26658801 2015 HIV-1/HAART-Related Lipodystrophy Syndrome (HALS) Is Associated with Decreased Circulating sTWEAK Levels.
26646413 2016 Comparative genomic analysis of eutherian tumor necrosis factor ligand genes.
26499979 2016 Serum levels of TWEAK in patients with psoriasis vulgaris.
26224570 2015 TWEAK/Fn14 interaction promotes oxidative stress through NADPH oxidase activation in macrophages.
26016896 2015 HPV Type 16 Infection Switches Keratinocytes from Apoptotic to Proliferative Fate under TWEAK/Fn14 Interaction.
25890309 2015 TWEAK enhances TGF-?-induced epithelial-mesenchymal transition in human bronchial epithelial cells.
25776497 2015 Regulatory Tweak/Fn14 signaling pathway as a potent target for controlling bone loss.
25681674 2015 Soluble TWEAK levels predict the presence of carotid atherosclerotic plaques in subjects free from clinical cardiovascular diseases.