Property Summary

NCBI Gene PubMed Count 14
PubMed Score 14.22
PubTator Score 11.93

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 8.3e-06
astrocytic glioma -1.200 4.3e-02
atypical teratoid / rhabdoid tumor -1.700 1.9e-08
glioblastoma -1.400 4.2e-08
group 4 medulloblastoma -1.200 2.2e-05
medulloblastoma, large-cell -1.900 2.1e-06
ovarian cancer -1.100 7.5e-06
Pick disease -1.100 6.7e-03
primitive neuroectodermal tumor -1.400 1.1e-04

Gene RIF (6)

AA Sequence

MQMSYAIRCAFYQLLLAALMLVAMLQLLYLSLLSGLHGQEEQDQYFEFFPPSPRSVDQVKAQLRTALASG      1 - 70
GVLDASGDYRVYRGLLKTTMDPNDVILATHASVDNLLHLSGLLERWEGPLSVSVFAATKEEAQLATVLAY     71 - 140
ALSSHCPDMRARVAMHLVCPSRYEAAVPDPREPGEFALLRSCQEVFDKLARVAQPGINYALGTNVSYPNN    141 - 210
LLRNLAREGANYALVIDVDMVPSEGLWRGLREMLDQSNQWGGTALVVPAFEIRRARRMPMNKNELVQLYQ    211 - 280
VGEVRPFYYGLCTPCQAPTNYSRWVNLPEESLLRPAYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRI    281 - 350
SQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC         351 - 415
//

Text Mined References (14)

PMID Year Title