Property Summary

NCBI Gene PubMed Count 58
PubMed Score 162.84
PubTator Score 36.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Breast Neoplasms 445 0.0 0.0
Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.638 1.8e-04
ovarian cancer -1.100 2.4e-03
pancreatic ductal adenocarcinoma liver m... -1.400 2.3e-02
Waldenstrons macroglobulinemia 1.220 4.9e-03

Synonym

Accession O43504 Q6IBD8
Symbols XIP
HBXIP

Gene

PDB

6EHP   6EHR   3MS6   3MSH  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (49)

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESD      1 - 70
NGNIMIQKHDGITVAVHKMAS                                                      71 - 91
//

Text Mined References (65)

PMID Year Title