Property Summary

NCBI Gene PubMed Count 45
Grant Count 24
R01 Count 12
Funding $4,803,148.12
PubMed Score 139.77
PubTator Score 36.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.220 0.005
Multiple myeloma 1.638 0.000
pancreatic ductal adenocarcinoma liver m... -1.400 0.023
ovarian cancer 1.700 0.003

Gene RIF (37)

PMID Text
26828265 Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer.
26719542 Results support a model in which the HBXIP/Hotair/LSD1 complex serves as a critical effector of c-Myc in activating transcription of its target genes, illuminating long-standing questions on how c-Myc drives carcinogenesis.
26309161 oncoprotein HBXIP enhances glucose metabolism reprogramming through suppressing SCO2 and PDHA1 in breast cancer
26229107 highly expressed HBXIP accelerates the MDM2-mediated degradation of p53 in breast cancer through modulating the feedback loop of MDM2/p53, resulting in the fast growth of breast cancer cells.
25686500 HBXIP promotes the migration of breast cancer cells through modulating microtubule acetylation mediated by GCN5.
25178941 Our study suggested that high HBXIP is associated with the progression of breast cancer. HBXIP could be a valuable prognostic marker as well as a potential molecular therapy target for breast cancer patients.
24886421 Hepatitis B protein HBx accelerates hepatocarcinogenesis with partner survivin through modulating tumor suppressor miR-520b and oncoprotein HBXIP.
24882622 HBXIP facilitates the proliferation of hepatoma cells by up-regulating SCG3 via E2F1 and miR-509-3p modulation.
24788380 Dta show that HBXIP was able to stimulate the activity of Skp2 promoter via transcription factor Sp1 thus promoting the migration of ovarian cancer cells.
24464787 The oncoprotein HBXIP enhances angiogenesis and growth of breast cancer through modulating FGF8 and VEGF.
More...

AA Sequence

MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESD      1 - 70
NGNIMIQKHDGITVAVHKMAS                                                      71 - 91
//

Text Mined References (53)

PMID Year Title
26828265 2016 The oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells.
26719542 2016 HBXIP and LSD1 Scaffolded by lncRNA Hotair Mediate Transcriptional Activation by c-Myc.
26309161 2015 The oncoprotein HBXIP promotes glucose metabolism reprogramming via downregulating SCO2 and PDHA1 in breast cancer.
26229107 2015 The oncoprotein HBXIP modulates the feedback loop of MDM2/p53 to enhance the growth of breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25686500 2015 The oncoprotein HBXIP promotes migration of breast cancer cells via GCN5-mediated microtubule acetylation.
25567906 2015 Metabolism. Lysosomal amino acid transporter SLC38A9 signals arginine sufficiency to mTORC1.
25561175 2015 SLC38A9 is a component of the lysosomal amino acid sensing machinery that controls mTORC1.
25178941 2014 HBXIP expression predicts patient prognosis in breast cancer.
24886421 2014 Hepatitis B virus X protein accelerates hepatocarcinogenesis with partner survivin through modulating miR-520b and HBXIP.
More...