Property Summary

NCBI Gene PubMed Count 89
PubMed Score 88.25
PubTator Score 88.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
ovarian cancer 8520 5.107 0.00211658066117854
Breast cancer 3578 4.283 2.1
Disease Target Count Z-score Confidence
Aplastic Anemia 21 4.744 2.4

Expression

  Differential Expression (5)

Disease log2 FC p
ovarian cancer -1.100 2.1e-03
acute myeloid leukemia -1.400 1.5e-02
group 3 medulloblastoma 1.100 5.7e-03
nasopharyngeal carcinoma 1.300 6.0e-05
tuberculosis and treatment for 6 months -1.300 8.0e-04

Protein-protein Interaction (5)

Gene RIF (64)

AA Sequence

MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLT      1 - 70
NKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAV     71 - 140
DVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYY    141 - 210
FRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAV    211 - 280
ILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTV    281 - 350
VTSACSLQTEGSLSTRKRSRDPEEEL                                                351 - 376
//

Text Mined References (92)

PMID Year Title