Property Summary

NCBI Gene PubMed Count 80
Grant Count 50
R01 Count 38
Funding $2,901,731.83
PubMed Score 80.11
PubTator Score 88.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
tuberculosis and treatment for 6 months -1.300 0.001
group 3 medulloblastoma 1.100 0.006
nasopharyngeal carcinoma 1.300 0.000
acute myeloid leukemia -1.400 0.015
ovarian cancer 1.300 0.000

Gene RIF (56)

PMID Text
26740214 RAD51C mutations were identified in 0.5 % of Danish families.
26406419 RAD51C mutation is not associated with high-risk patients from Serbian hereditary breast/ovarian cancer.
26261251 RAD51C and RAD51D are moderate ovarian cancer susceptibility genes.
26057125 a mutation analysis in 171 high-risk BRCA1 and BRCA2 negative ovarian cancer patients, to evaluate the frequency of hereditary RAD51C and RAD51D variants in Czech population, is reported.
25669972 Novel Rad51C splice variants occur in colorectal tumors and cells: Variant 1 without exon-7, Variant 2 without exon 6 and 7 , or Variant 3 without exon 7 and 8. They are associated with FANCD2 foci positive colorectal tumors and microsatellite stability.
25343521 The effect of common single nucleotide polymorphisms (SNPs) in non-coding regions of RAD51C in modulating the risk of breast cancer was investigated.
25292178 Mutations in RAD51C are associated with drug resistance in breast cancer.
25154786 conclude that the woman has two potential disease-causing mutations and that predictive testing of family members should include both the RAD51C and BRCA2 mutation
25086635 RAD51C mutation is associated with breast and ovarian cancer.
24800917 The findings suggest that RAD51C plays a marginal role in breast and ovarian cancer predisposition in Pakistan.
More...

AA Sequence

MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEVGISKAEALETLQIIRRECLT      1 - 70
NKPRYAGTSESHKKCTALELLEQEHTQGFIITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLCMQLAV     71 - 140
DVQIPECFGGVAGEAVFIDTEGSFMVDRVVDLATACIQHLQLIAEKHKGEEHRKALEDFTLDNILSHIYY    141 - 210
FRCRDYTELLAQVYLLPDFLSEHSKVRLVIVDGIAFPFRHDLDDLSLRTRLLNGLAQQMISLANNHRLAV    211 - 280
ILTNQMTTKIDRNQALLVPALGESWGHAATIRLIFHWDRKQRLATLYKSPSQKECTVLFQIKPQGFRDTV    281 - 350
VTSACSLQTEGSLSTRKRSRDPEEEL                                                351 - 376
//

Text Mined References (83)

PMID Year Title
26740214 2016 Identification of six pathogenic RAD51C mutations via mutational screening of 1228 Danish individuals with increased risk of hereditary breast and/or ovarian cancer.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26406419 2015 RAD51C mutation screening in high-risk patients from Serbian hereditary breast/ovarian cancer families.
26261251 2015 Contribution of Germline Mutations in the RAD51B, RAD51C, and RAD51D Genes to Ovarian Cancer in the Population.
26057125 2015 Mutation Analysis of the RAD51C and RAD51D Genes in High-Risk Ovarian Cancer Patients and Families from the Czech Republic.
25669972 2015 Overexpression of Rad51C splice variants in colorectal tumors.
25343521 2014 Single nucleotide polymorphisms in noncoding regions of Rad51C do not change the risk of unselected breast cancer but they modulate the level of oxidative stress and the DNA damage characteristics: a case-control study.
25292178 2015 Enhanced non-homologous end joining contributes toward synthetic lethality of pathological RAD51C mutants with poly (ADP-ribose) polymerase.
25154786 2015 Identification of a breast cancer family double heterozygote for RAD51C and BRCA2 gene mutations.
25086635 2014 RAD51C germline mutations found in Spanish site-specific breast cancer and breast-ovarian cancer families.
More...