Property Summary

NCBI Gene PubMed Count 25
Grant Count 28
R01 Count 8
Funding $2,312,292.4
PubMed Score 106.17
PubTator Score 90.31

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
24910430 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
24221250 These results indicate that hepatitis E virus (HEV)forms membrane-associated particles in the cytoplasm, and that the released HEV particles with a lipid membrane retain the antigenicity of TGOLN2 on their surface.
21900423 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
21607084 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
21563830 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
20926557 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
20468057 These analyses do not provide support for the hypothesis that common genetic variation in TGOLN2 contributes significantly to the risk for attempted suicide in subjects with major mood disorders.
20468057 Observational study of gene-disease association. (HuGE Navigator)
20386718 HIV-1 Vpu co-localizes with the trans-golgi network protein TGN46 in CD4+ T cells
20138391 These data have identified different itineraries for the retrograde transport of Shiga toxin and TGN38 and distinct retromer components that regulate the transport of these cargos.
More...

AA Sequence

MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKS      1 - 70
SAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKS     71 - 140
GAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKS    141 - 210
GAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADT    211 - 280
NQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSA    281 - 350
SSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK    351 - 420
VTRRPKASDYQRLDQKYVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL              421 - 480
//

Text Mined References (38)

PMID Year Title
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24221250 2014 The membrane on the surface of hepatitis E virus particles is derived from the intracellular membrane and contains trans-Golgi network protein 2.
23386608 2013 Dynamics of the rhomboid-like protein RHBDD2 expression in mouse retina and involvement of its human ortholog in retinitis pigmentosa.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22456507 2012 Dynamic and transient interactions of Atg9 with autophagosomes, but not membrane integration, are required for autophagy.
21994457 2011 VPg-primed RNA synthesis of norovirus RNA-dependent RNA polymerases by using a novel cell-based assay.
More...