Property Summary

NCBI Gene PubMed Count 26
PubMed Score 106.00
PubTator Score 90.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute myeloid leukemia 1.600 2.2e-03
astrocytoma 1.300 2.6e-02
atypical teratoid / rhabdoid tumor 1.100 4.7e-06
autosomal dominant Emery-Dreifuss muscul... 1.040 9.1e-03
esophageal adenocarcinoma 1.400 2.5e-02
glioblastoma 1.300 3.1e-03
intraductal papillary-mucinous adenoma (... 1.500 6.3e-03
intraductal papillary-mucinous carcinoma... 1.500 1.1e-02
lung cancer -1.200 3.6e-02
medulloblastoma, large-cell -1.500 5.5e-04
Multiple myeloma 1.113 2.2e-02
ovarian cancer -2.000 4.3e-07
psoriasis 1.500 7.1e-05
Rheumatoid arthritis 1.200 2.0e-02

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MRFVVALVLLNVAAAGAVPLLATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKS      1 - 70
SAEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKDSTSKSHPELQTPKDSTGKS     71 - 140
GAEAQTPEDSPNRSGAEAKTQKDSPSKSGSEAQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKS    141 - 210
GAEKQTPKDGSNKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKADT    211 - 280
NQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAEDDDTGPEEGSPPKEEKEKMSGSA    281 - 350
SSENREGTLSDSTGSEKDDLYPNGSGNGSAESSHFFAYLVTAAILVAVLYIAHHNKRKIIAFVLEGKRSK    351 - 420
VTRRPKASDYQRLDQKYVLILNVFPAPPKRSFLPQVLTEWYIPLEKDERHQWIVLLSFQL              421 - 480
//

Text Mined References (39)

PMID Year Title