Property Summary

NCBI Gene PubMed Count 21
Grant Count 50
R01 Count 6
Funding $8,706,108.26
PubMed Score 354.86
PubTator Score 125.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.300 0.000
hereditary spastic paraplegia 1.189 0.004
adrenocortical carcinoma -1.112 0.001
tuberculosis 1.500 0.000
lung cancer 1.200 0.001
Breast cancer 2.400 0.030
group 3 medulloblastoma 1.100 0.001
posterior fossa group B ependymoma 1.400 0.000
lung carcinoma 1.300 0.000
ovarian cancer 1.100 0.010

Gene RIF (8)

PMID Text
25451587 AKR7A2 contributes to protection against MG-induced toxicity.
25027672 induced expression in human monocytes following exposure to Aflatoxin B1
21044367 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
19077459 Aflatoxin B(1) aldehyde reductase (AKR7A2) was confirmed to be only highly expressed in pancreatic cancer, not in normal adjacent pancreas and benign tumors.
18752886 The human AFAR gene family maps to a genomic region in 1p36 of frequent hemizygous deletions in various human cancers.
17591773 The human aldo-keto reductase AKR7A2 has been proposed previously to catalyze the NADPH-dependent reduction of succinic semialdehyde (SSA) to gamma-Hydroxybutyrate in human brain
12879023 structure and tissue-related expression of AFAR genes on chromosome 1

AA Sequence

MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTE      1 - 70
LDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYL     71 - 140
HAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETE    141 - 210
LFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKAL    211 - 280
QAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLV    281 - 350
AHECPNYFR                                                                 351 - 359
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25451587 2015 Nrf2-mediated adaptive response to methyl glyoxal in HepG2 cells involves the induction of AKR7A2.
25027672 GST-M1 is transcribed moreso than AKR7A2 in AFB?-exposed human monocytes and lymphocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20837989 2010 Naturally occurring variants of human aldo-keto reductases with reduced in vitro metabolism of daunorubicin and doxorubicin.
More...