Property Summary

NCBI Gene PubMed Count 22
PubMed Score 369.55
PubTator Score 125.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
tuberculosis 1.500 2.8e-09
adrenocortical carcinoma -1.112 7.1e-04
Breast cancer 2.400 3.0e-02
group 3 medulloblastoma 1.100 6.7e-04
hereditary spastic paraplegia 1.189 4.1e-03
lung cancer 1.200 7.2e-04
lung carcinoma 1.300 3.6e-32
ovarian cancer 1.100 9.8e-03
posterior fossa group A ependymoma 1.100 5.6e-06
psoriasis 1.300 4.3e-04

Gene RIF (9)

AA Sequence

MLSAASRVVSRAAVHCALRSPPPEARALAMSRPPPPRVASVLGTMEMGRRMDAPASAAAVRAFLERGHTE      1 - 70
LDTAFMYSDGQSETILGGLGLGLGGGDCRVKIATKANPWDGKSLKPDSVRSQLETSLKRLQCPQVDLFYL     71 - 140
HAPDHGTPVEETLHACQRLHQEGKFVELGLSNYASWEVAEICTLCKSNGWILPTVYQGMYNATTRQVETE    141 - 210
LFPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPVGRFFGNSWAETYRNRFWKEHHFEAIALVEKAL    211 - 280
QAAYGASAPSVTSAALRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAATEEGPLEPAVVDAFNQAWHLV    281 - 350
AHECPNYFR                                                                 351 - 359
//

Text Mined References (27)

PMID Year Title