Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.64
PubTator Score 12.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 8.01644885041107E-22
atypical teratoid/rhabdoid tumor 1095 5.38467618814656E-15
psoriasis 6685 3.21123192246076E-14
Breast cancer 3099 7.52126282034347E-12
glioblastoma 5572 7.82785354699753E-10
sonic hedgehog group medulloblastoma 1482 5.81081540043707E-9
malignant mesothelioma 3163 3.82148690155178E-8
pediatric high grade glioma 2712 7.05566837126914E-8
posterior fossa group A ependymoma 1511 1.16809043798498E-7
primitive neuroectodermal tumor 3031 2.41236894181614E-7
medulloblastoma, large-cell 6234 7.17845215710821E-7
breast carcinoma 1614 6.26900234102874E-5
invasive ductal carcinoma 2950 2.4476401101397E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.40617593832298E-4
ovarian cancer 8492 4.53182682704709E-4
nasopharyngeal carcinoma 1056 5.25125671932976E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.535501657577E-4
ductal carcinoma in situ 1745 0.00271029360309574
lung cancer 4473 0.00372439844629662
adrenocortical carcinoma 1427 0.00968425517775246
Endometriosis 535 0.0353563877092385

Expression

Synonym

Accession O43482 Q96BX7
Symbols CT86
MIS18B
LINT-25
MIS18beta
hMIS18beta
5730547N13Rik

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA Inparanoid

 GO Function (1)

Gene RIF (8)

PMID Text
26942680 Stable binding of Mis18alpha-Mis18beta heterotetramer to centromeres in telophase licenses them for CENP-A deposition.
26107214 Over-expression of OIP5 was observed in breast tumors.
24519934 Mis18beta binds with and specifies the centromere localization of HJURP.
24269809 this study showed betaTrCP-mediated regulation of Mis18beta stability is a mechanism to restrict centromere function of Mis18 complex from late mitosis to early G1 phase.
23292864 expression of AURKC, OIP5, PIWIL2 and TAF7L differed between patients with Acute myeloid leukemia, myelodysplastic syndrome and healthy controls in a gender-dependent manner
22129094 OIP5 expression was significantly associated with poor prognosis of lung and esophageal cancer patients
20510019 These results indicate that knockdown of OIP5 may induce apoptosis in cancer cells.
17199038 Three human proteins essential for centromere/kinetochore structure and function, hMis18alpha, hMis18beta, and M18BP1, the complex of which is accumulated specifically at the telophase-G1 centromere, are identified.[Mis18alpha, Mis18beta, M18BP1]

AA Sequence

MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL      1 - 70
QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC     71 - 140
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL    141 - 210
KSLMKILSEVTPDQSKPEN                                                       211 - 229
//

Text Mined References (23)

PMID Year Title
26942680 2016 Licensing of Centromeric Chromatin Assembly through the Mis18?-Mis18? Heterotetramer.
26921242 2016 Centromere localization and function of Mis18 requires Yippee-like domain-mediated oligomerization.
26107214 2015 Cancer/Testis OIP5 and TAF7L Genes are Up-Regulated in Breast Cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25036634 2014 Polo-like kinase 1 licenses CENP-A deposition at centromeres.
24519934 2014 Mitotic regulator Mis18? interacts with and specifies the centromeric assembly of molecular chaperone holliday junction recognition protein (HJURP).
24269809 2014 ?TrCP-mediated ubiquitylation regulates protein stability of Mis18? in a cell cycle-dependent manner.
23292864 2013 Expression analysis of four testis-specific genes AURKC, OIP5, PIWIL2 and TAF7L in acute myeloid leukemia: a gender-dependent expression pattern.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22129094 2012 Characterization of an Opa interacting protein 5 involved in lung and esophageal carcinogenesis.
More...