Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.74
PubTator Score 12.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.455 9.7e-03
adult high grade glioma 1.900 1.3e-04
atypical teratoid / rhabdoid tumor 2.500 6.8e-10
Breast cancer 2.000 7.5e-12
breast carcinoma 1.800 6.3e-05
ductal carcinoma in situ 1.500 2.7e-03
Endometriosis 1.039 3.5e-02
ependymoma 1.800 3.5e-08
glioblastoma 2.400 7.8e-10
group 3 medulloblastoma 3.200 6.8e-07
intraductal papillary-mucinous carcinoma... 1.500 7.5e-04
intraductal papillary-mucinous neoplasm ... 2.400 3.4e-04
invasive ductal carcinoma 1.800 2.4e-04
lung cancer 1.600 3.7e-03
malignant mesothelioma 2.100 3.8e-08
medulloblastoma, large-cell 2.800 7.2e-07
nasopharyngeal carcinoma 1.400 5.3e-04
non-small cell lung cancer 2.640 8.0e-22
ovarian cancer 1.300 4.5e-04
primitive neuroectodermal tumor 2.800 2.4e-07
psoriasis 1.600 3.2e-14

Gene RIF (13)

AA Sequence

MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWL      1 - 70
QPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSC     71 - 140
GIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRL    141 - 210
KSLMKILSEVTPDQSKPEN                                                       211 - 229
//

Text Mined References (29)

PMID Year Title