Property Summary

NCBI Gene PubMed Count 254
Grant Count 509
R01 Count 297
Funding $54,514,993.39
PubMed Score 682.63
PubTator Score 473.41

Knowledge Summary

Patent

No data available

Expression

Synonym

Gene

Gene RIF (240)

PMID Text
27027284 studies identify gain of MEKK3 signalling and KLF2/4 function as causal mechanisms for cerebral cavernous malformations pathogenesis that may be targeted to develop new CCM therapeutics
26676883 KLF4-regulated drug resistance might, at least partially, positively regulate high-mobility group box 1 (HMGB1), which is a significant contributor to chemoresistance in osteosarcoma cells
26654770 Several novel and known AKT phosphorylation sites are identified within OCT4, SOX2 and KLF4.
26644403 Decreased KLF4 expression mediates antileukemic effects through regulation of gene and microRNA networks, containing miR-150, CDKN1A, and MYC.
26546821 CREB enhances KLF4 up-regulatory effect on apoE promoter.
26517087 KLF4 might play Janus-faced roles in oral squamous cell carcinoma, acting both as a tumor suppressor and as an oncogene.
26471298 conclude that miR-32 promotes GC cell proliferation, migration and invasion by targeting KLF4, suggesting that the miR-32-KLF4 pathway may be useful in clinical diagnosis and therapeutics
26457418 Kruppel-Like Factor 4 Overexpression Initiates a Mesenchymal-to-Epithelial Transition and Redifferentiation of Human Pancreatic Cells following Expansion in Long Term Adherent Culture
26431332 KLF4, together with BLIMP1, plays a critical role in mediating lytic Epstein-Barr virus reactivation in epithelial cells.
26420673 Arginine methylation of KLF4 by PRMT5 inhibits KLF4 ubiquitylation by VHL and thereby reduces KLF4 turnover.
More...

AA Sequence

MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATV      1 - 70
ATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSG     71 - 140
PASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDP    141 - 210
VYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQE    211 - 280
AVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPS    281 - 350
FLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR    351 - 420
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPF    421 - 490
QCQKCDRAFSRSDHLALHMKRHF                                                   491 - 513
//

Text Mined References (263)

PMID Year Title
27027284 2016 Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling.
26676883 2016 Krüppel-like factor 4 promotes high-mobility group box 1-induced chemotherapy resistance in osteosarcoma cells.
26654770 2015 Novel AKT phosphorylation sites identified in the pluripotency factors OCT4, SOX2 and KLF4.
26644403 2015 Deregulated KLF4 Expression in Myeloid Leukemias Alters Cell Proliferation and Differentiation through MicroRNA and Gene Targets.
26546821 2015 Krüppel-like factor 4 synergizes with CREB to increase the activity of apolipoprotein E gene promoter in macrophages.
26517087 2015 The Janus-faced roles of Krüppel-like factor 4 in oral squamous cell carcinoma cells.
26471298 2015 MiR-32 promotes gastric carcinoma tumorigenesis by targeting Kruppel-like factor 4.
26457418 2015 Krüppel-Like Factor 4 Overexpression Initiates a Mesenchymal-to-Epithelial Transition and Redifferentiation of Human Pancreatic Cells following Expansion in Long Term Adherent Culture.
26431332 2015 Differentiation-Dependent KLF4 Expression Promotes Lytic Epstein-Barr Virus Infection in Epithelial Cells.
26420673 2015 Interplay between arginine methylation and ubiquitylation regulates KLF4-mediated genome stability and carcinogenesis.
More...