Property Summary

NCBI Gene PubMed Count 309
PubMed Score 774.08
PubTator Score 473.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Meningioma 41 0.0 1.3
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.029367120755106
Disease Target Count Z-score Confidence
Cancer 2499 5.192 2.6

Expression

  Differential Expression (38)

Disease log2 FC p
Breast cancer -3.100 2.9e-02
acute quadriplegic myopathy 1.723 1.1e-02
adrenocortical carcinoma -2.028 2.9e-04
astrocytoma 2.100 4.6e-02
Atopic dermatitis -1.800 9.6e-04
autosomal dominant Emery-Dreifuss muscul... 2.209 1.9e-02
breast carcinoma -1.700 2.9e-05
chronic lymphosyte leukemia -1.500 3.5e-03
chronic rhinosinusitis -1.297 3.0e-02
colon cancer -1.800 2.6e-02
Down syndrome 1.400 1.1e-02
ductal carcinoma in situ -1.300 8.7e-03
fascioscapulohumeral muscular dystrophy 1.498 8.9e-03
fibroadenoma -1.700 8.3e-03
gastric cancer -1.800 3.4e-03
glioblastoma 1.300 4.2e-02
group 4 medulloblastoma -1.100 5.3e-03
intraductal papillary-mucinous adenoma (... 1.500 1.6e-03
intraductal papillary-mucinous carcinoma... 1.100 2.3e-03
intraductal papillary-mucinous neoplasm ... 2.500 7.2e-03
invasive ductal carcinoma -1.384 4.5e-03
juvenile dermatomyositis 1.250 8.0e-04
lung adenocarcinoma -1.700 9.2e-11
lung cancer -2.000 6.0e-04
lung carcinoma -3.200 5.2e-22
medulloblastoma, large-cell -2.700 1.7e-03
nasopharyngeal carcinoma -1.100 2.1e-02
non-small cell lung cancer -1.715 3.8e-09
ovarian cancer -4.100 3.9e-09
pancreatic cancer -1.700 6.8e-03
pancreatic carcinoma -1.700 6.8e-03
pituitary cancer -2.000 1.9e-04
primary pancreatic ductal adenocarcinoma 2.275 2.5e-02
psoriasis -1.600 1.3e-03
Rheumatoid arthritis 1.300 5.3e-03
spina bifida -1.090 2.2e-02
tuberculosis 2.100 1.3e-04
ulcerative colitis -1.100 4.5e-04

Gene RIF (293)

AA Sequence

MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATV      1 - 70
ATDLESGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSG     71 - 140
PASAPSTCSFTYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDP    141 - 210
VYIPPQQPQPPGGGLMGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQE    211 - 280
AVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPS    281 - 350
FLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRR    351 - 420
SWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPF    421 - 490
QCQKCDRAFSRSDHLALHMKRHF                                                   491 - 513
//

Text Mined References (318)

PMID Year Title