Property Summary

NCBI Gene PubMed Count 118
PubMed Score 392.49
PubTator Score 176.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.879 2.8e-10
ovarian cancer 1.700 8.5e-06
psoriasis 1.800 8.6e-05

Gene RIF (96)

AA Sequence

MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRA      1 - 70
CLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPP     71 - 140
ASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRL    141 - 210
LSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQR    211 - 280
PARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNS    281 - 350
SSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM    351 - 420
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE                                    421 - 458
//

Text Mined References (121)

PMID Year Title