Property Summary

NCBI Gene PubMed Count 114
Grant Count 76
R01 Count 50
Funding $9,235,288.66
PubMed Score 368.37
PubTator Score 176.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.800 0.000
osteosarcoma -2.879 0.000
ovarian cancer 1.700 0.000

Synonym

Accession O43464 Q9HBZ4 Q9P0Y3 Q9P0Y4
Symbols OMI
PARK13
PRSS25

Gene

PANTHER Protein Class (3)

PDB

1LCY   2PZD   5FHT  

Gene RIF (92)

PMID Text
26702898 The a5 helix of PDZ was involved in both, the intra- and intersubunit changes of interactions and thus seems to play an important role in HtrA2 activation.
26340347 The NG2 proteoglycan protects oligodendrocyte precursor cells against oxidative stress via interaction with OMI/HtrA2.
25791756 study examined the association of HTRA2 p.G399S mutation with essential tremor(ET) and Parkinson disease (PD) in Asians and found that HTRA2 p.G399S is rare and does not appear to play a major role in subjects with coexistent ET and PD nor in those with pure ET or PD phenotype
25628093 HtrA2 expression was a predictor for sensitivity to chemotherapy, and could be a candidate of molecular target in the treatment of high-grade serous ovarian cancers.
25484138 Omi/HtrA2 overexpression promotes hepatocellular carcinoma cell apoptosis and the ped/pea-15 expression level causes this difference of the Omi/HtrA2 pro-apoptotic marker in the various hepatocellular carcinoma cell lines
25422467 results suggest that in some families, HTRA2 p.G399S is responsible for hereditary essential tremor and that homozygotes for this allele develop Parkinson disease
25288153 HtrA2 under stress conditions induces vimentin cleavage in wild-type and SH-SY5Y cells transfected with ABP with the Alzheimer disease-associated Swedish mutation. Interplay between Omi/HtrA2 and vimentin affects mitochondrial distribution in neurons.
25086674 HtrA2 might promote the apoptosis of non-small cell lung cancer cells, and serve as a target for NSCLC's treatment.
24798695 This study shows that PARK13 and PINK1 are subcellular-specific, but dynamic, proteins with a reciprocal molecular relationship.
24698088 demonstrate a novel N-terminal ligand-mediated triggering of an allosteric switch essential for transforming HtrA2 to a proteolytically competent state in a PDZ-independent yet synergistic activation process
More...

AA Sequence

MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWARLSVGVTEPRA      1 - 70
CLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPP     71 - 140
ASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVVADRRRVRVRL    141 - 210
LSGDTYEAVVTAVDPVADIATLRIQTKEPLPTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQR    211 - 280
PARDLGLPQTNVEYIQTDAAIDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNS    281 - 350
SSGISGSQRRYIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM    351 - 420
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE                                    421 - 458
//

Text Mined References (116)

PMID Year Title
26702898 2016 Intra- and intersubunit changes accompanying thermal activation of the HtrA2(Omi) protease homotrimer.
26340347 2015 The NG2 Proteoglycan Protects Oligodendrocyte Precursor Cells against Oxidative Stress via Interaction with OMI/HtrA2.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25791756 2015 Mitochondrial serine protease HTRA2 gene mutation in Asians with coexistent essential tremor and Parkinson disease.
25628093 2015 High-temperature-required protein A2 as a predictive marker for response to chemotherapy and prognosis in patients with high-grade serous ovarian cancers.
25484138 2015 Omi/HtrA2 pro-apoptotic marker differs in various hepatocellular carcinoma cell lines owing to ped/pea-15 expression level.
25422467 2014 Mitochondrial serine protease HTRA2 p.G399S in a kindred with essential tremor and Parkinson disease.
25288153 2015 Stress Conditions Increase Vimentin Cleavage by Omi/HtrA2 Protease in Human Primary Neurons and Differentiated Neuroblastoma Cells.
25118933 2014 The protease Omi regulates mitochondrial biogenesis through the GSK3?/PGC-1? pathway.
25086674 2014 The expression levels and prognostic value of high temperature required A2 (HtrA2) in NSCLC.
More...