Property Summary

NCBI Gene PubMed Count 90
Grant Count 57
R01 Count 34
Funding $5,920,898.46
PubMed Score 149.44
PubTator Score 123.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.339 0.000
lung cancer 1.200 0.011

Synonym

Accession O43463 B2R6E8 B4DST0 Q53G60 Q6FHK6
Symbols MG44
KMT1A
SUV39H
H3-K9-HMTase 1

Gene

PDB

3MTS  

Gene RIF (38)

PMID Text
26807716 we describe the synthesis of multidomain 'designer chromatin' templates and their application to dissecting the regulation of human Suv39h1
25204660 PHF2 is likely to repress rDNA transcription by competing with PHF8 for binding of ribosomal DNA promoter and by recruiting H3K9me2/3 methyltransferase SUV39H1.
25063769 These results suggest a model in which SUV39H1 downregulation promotes the establishment of cellular senescence.
24844570 High SUV39H1 expression is associated with hepatocellular carcinoma.
24737085 Suv39H1 induced apoptosis and inhibited cell proliferation in the gastric cancer MGC803 cell line, while decreasing BCL-2, pro-caspase-9, pro-caspase-3 and C-myc. Suv39H1 may be a potential gene target for anti-gastric carcinoma therapy.
24588869 results suggest that Suv39 h1-H3K9me3 epigenetic repression is involved in BZLF1 transcriptional silencing, providing a molecular basis for understanding the mechanism by which EBV latency is maintained
24501407 Short-chain fatty acids from periodontal pathogens suppress EZH2, and SUV39H1 to promote Kaposi's sarcoma-associated herpesvirus replication.
24292684 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing
23943221 SUV39H1 expression was upregulated in glioma cell lines and in glioma tissues compared to normal brain, being positively correlated with grade and histological malignancy.
23509280 Methylation of SUV39H1 by SET7/9 results in heterochromatin relaxation and genome instability.
More...

AA Sequence

MAENLKGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLCDYKKIREQEYYLVKWRGYPDS      1 - 70
ESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKTPRHLDPSLANYLVQKAKQRRALRRWEQELNAKRS     71 - 140
HLGRITVENEVDLDGPPRAFVYINEYRVGEGITLNQVAVGCECQDCLWAPTGGCCPGASLHKFAYNDQGQ    141 - 210
VRLRAGLPIYECNSRCRCGYDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITS    211 - 280
EEAERRGQIYDRQGATYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAFF    281 - 350
ATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF            351 - 412
//

Text Mined References (97)

PMID Year Title
26807716 2016 A two-state activation mechanism controls the histone methyltransferase Suv39h1.
25416956 2014 A proteome-scale map of the human interactome network.
25204660 2014 PHD finger protein 2 (PHF2) represses ribosomal RNA gene transcription by antagonizing PHF finger protein 8 (PHF8) and recruiting methyltransferase SUV39H1.
25063769 2014 A role for SUV39H1-mediated H3K9 trimethylation in the control of genome stability and senescence in WI38 human diploid lung fibroblasts.
24844570 2015 Histone lysine methyltransferase SUV39H1 is a potent target for epigenetic therapy of hepatocellular carcinoma.
24737085 2014 Aberrant histone methylation and the effect of Suv39H1 siRNA on gastric carcinoma.
24588869 2014 Role of the histone H3 lysine 9 methyltransferase Suv39 h1 in maintaining Epsteinn-Barr virus latency in B95-8 cells.
24501407 2014 Short-chain fatty acids from periodontal pathogens suppress histone deacetylases, EZH2, and SUV39H1 to promote Kaposi's sarcoma-associated herpesvirus replication.
24292684 2015 CRL4B promotes tumorigenesis by coordinating with SUV39H1/HP1/DNMT3A in DNA methylation-based epigenetic silencing.
23943221 2014 Role of histone lysine methyltransferases SUV39H1 and SETDB1 in gliomagenesis: modulation of cell proliferation, migration, and colony formation.
More...