Property Summary

NCBI Gene PubMed Count 25
PubMed Score 27956.43
PubTator Score 81.94

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Diabetes mellitus type 2 69
Disease Target Count P-value
non-small cell lung carcinoma 413 1.70334547503243E-15
malignant mesothelioma 3163 1.94666090597354E-9
lung adenocarcinoma 2714 3.1186761791103E-9
lung cancer 4473 2.34080904374682E-6
lung carcinoma 2844 4.41052000457691E-5
osteosarcoma 7933 6.24052559661076E-5
cystic fibrosis 1670 6.61328280668061E-5
tuberculosis and treatment for 6 months 686 4.71779754874467E-4
Rheumatoid Arthritis 1171 0.0060223893744557
mucosa-associated lymphoid tissue lymphoma 480 0.0198553356138223
nephrosclerosis 329 0.0484905651157127
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis 2.200 0.006
nephrosclerosis -1.727 0.048
malignant mesothelioma -7.600 0.000
osteosarcoma -5.545 0.000
cystic fibrosis -1.790 0.000
tuberculosis and treatment for 6 months -2.000 0.000
non-small cell lung carcinoma -1.200 0.000
lung cancer -3.200 0.000
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.200 0.000
mucosa-associated lymphoid tissue lympho... 2.555 0.020


Accession O43451 Q0VAX6 Q75ME7 Q86UM5
Symbols MG


PANTHER Protein Class (2)


2QLY   2QMJ   3CTT   3L4T   3L4U   3L4V   3L4W   3L4X   3L4Y   3L4Z   3TON   3TOP  

  Ortholog (5)

Species Source
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

 GWAS Trait (1)

Gene RIF (14)

25776870 MGAM, or nearby regulatory elements, may be involved in the etiology of oral clefts.
25037326 Starch internal structure modulates its susceptibility to MGAM. The internal branch amounts negatively affect the glucose release rate.
23405089 The over-expression of MGAM was confirmed with a 6.6 fold increase in expression at the mRNA level whereas the fold change in ADAM9 demonstrated a 1.6 fold increase.
22563462 Findings suggest that C-terminal subunits of recombinant maltase-glucoamylase (MGAM) assists alpha-amylase in digesting starch molecules and potentially may compensate for developmental or pathological amylase deficiencies.
22058037 we report crystal structures of C-terminal maltase-glucoamylase alone at a resolution of 3.1 angstroms, and in complex with its inhibitor acarbose
22036121 These results suggest that the N-terminal and C-terminal catalytic domains of maltase-glucoamylase differ in their substrate specificities and inhibitor tolerance despite their structural relationship
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20356844 analysis of substrate selectivity of human maltase-glucoamylase and sucrase-isomaltase N-terminal domains
19913121 Observational study of gene-disease association. (HuGE Navigator)
19472353 This study reported the first diagnosed Finnish patient with a phenotype compatible with the late-onset form of Pompe disease. Molecular genetic analysis of the GAA gene revealed a novel missense mutation (Y575X),combined with (P545L) mutation.

AA Sequence

ITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWISTL                                    1821 - 1857

Text Mined References (26)

PMID Year Title
25776870 2015 A genome-wide study of inherited deletions identified two regions associated with nonsyndromic isolated oral clefts.
25037326 2014 Branch pattern of starch internal structure influences the glucogenesis by mucosal Nt-maltase-glucoamylase.
24816252 2014 An atlas of genetic influences on human blood metabolites.
23966204 2014 GWAS of human bitter taste perception identifies new loci and reveals additional complexity of bitter taste genetics.
23568457 2013 Genetic variants associated with disordered eating.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23405089 2013 Genome wide analysis of chromosomal alterations in oral squamous cell carcinomas revealed over expression of MGAM and ADAM9.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22563462 2012 Unexpected high digestion rate of cooked starch by the Ct-maltase-glucoamylase small intestine mucosal ?-glucosidase subunit.
22058037 2011 Structural insight into substrate specificity of human intestinal maltase-glucoamylase.