Property Summary

Ligand Count 58
NCBI Gene PubMed Count 25
PubMed Score 32564.43
PubTator Score 81.94

Knowledge Summary


No data available


  Disease (4)


  Differential Expression (11)

Disease log2 FC p
cystic fibrosis -1.790 6.6e-05
lung adenocarcinoma -1.200 3.1e-09
lung cancer -3.000 6.0e-05
lung carcinoma -1.200 4.4e-05
malignant mesothelioma -7.600 1.9e-09
mucosa-associated lymphoid tissue lympho... 2.555 2.0e-02
nephrosclerosis -1.727 4.8e-02
non-small cell lung cancer -1.156 3.3e-11
osteosarcoma -5.545 6.2e-05
Rheumatoid arthritis 2.200 6.0e-03
tuberculosis -1.600 2.9e-03

Gene RIF (14)

AA Sequence

ITPSFNNDPTTQVLSIDVTDRNISLHNFTSLTWISTL                                    1821 - 1857

Text Mined References (26)

PMID Year Title