Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
R01 Count 2
Funding $264,442.67
PubMed Score 4.88
PubTator Score 4.22

Knowledge Summary

Patent (253)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.116 0.000

AA Sequence

MQVSIACTEQNLRSRSSEDRLCGPRPGPGGGNGGPAGGGHGNPPGGGGSGPKARAALVPRPPAPAGALRE      1 - 70
STGRGTGMKYRNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEVYAAGKAERTL     71 - 140
GNILKSKGWRRSSYVITTKIFWGGQAETERGLSRKHIIEGLRGSLERLQLGYVDIVFANRSDPNCPMEEI    141 - 210
VRAMTYVINQGLALYWGTSRWGAAEIMEAYSMARQFNLIPPVCEQAEHHLFQREKVEMQLPELYHKIGVG    211 - 280
SVTWYPLACGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIA    281 - 350
WCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK                    351 - 404
//

Text Mined References (6)

PMID Year Title
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9857044 1998 Coexpression of the KCNA3B gene product with Kv1.5 leads to a novel A-type potassium channel.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7649300 1995 Alternative splicing of the human Shaker K+ channel beta 1 gene and functional expression of the beta 2 gene product.