Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $88,433.33
PubMed Score 21.67
PubTator Score 11.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
ependymoma -1.100 0.010
oligodendroglioma -1.100 0.006
lung cancer 1.300 0.003
group 3 medulloblastoma 1.200 0.002
ovarian cancer 1.100 0.001

Synonym

Accession O43447 A6NNE7 PPIase H
Symbols CYPH
CYP-20
USA-CYP
SnuCyp-20

Gene

PANTHER Protein Class (1)

PDB

1MZW   1QOI  

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human peptidylprolyl isomerase H (PPIH; cyclophilin H) at amino acid residues 69-70 by the HIV-1 protease
12875835 Free and complexed cyclophilin H have virtually identical conformations suggesting that the U4/U6-60K binding site is pre-shaped and the peptidyl-prolyl-cis/trans isomerase activity is unaffected by complex formation

AA Sequence

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK      1 - 70
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV     71 - 140
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM                                     141 - 177
//

Text Mined References (21)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25383878 2014 Identification of a PRPF4 loss-of-function variant that abrogates U4/U6.U5 tri-snRNP integration and is associated with retinitis pigmentosa.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21269460 2011 Initial characterization of the human central proteome.
19932913 2010 Multiple cyclophilins involved in different cellular pathways mediate HCV replication.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
16723661 2006 The network of protein-protein interactions within the human U4/U6.U5 tri-snRNP.
More...