Property Summary

NCBI Gene PubMed Count 15
PubMed Score 23.31
PubTator Score 11.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.100 1.0e-02
group 3 medulloblastoma 1.200 1.6e-03
lung cancer 1.300 2.6e-03
malignant mesothelioma 1.500 9.2e-06
oligodendroglioma -1.100 6.1e-03
ovarian cancer 1.100 1.4e-03

Gene RIF (2)

AA Sequence

MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIK      1 - 70
DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHVV     71 - 140
FGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM                                     141 - 177
//

Text Mined References (21)

PMID Year Title