Property Summary

NCBI Gene PubMed Count 22
Grant Count 23
R01 Count 15
Funding $1,129,097.98
PubMed Score 10.64
PubTator Score 8.86

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -2.500 0.000
osteosarcoma -1.798 0.000
sonic hedgehog group medulloblastoma 1.800 0.000
medulloblastoma, large-cell 1.100 0.000
tuberculosis -1.100 0.000
intraductal papillary-mucinous carcinoma... 1.400 0.006
lung cancer 1.500 0.004
lung carcinoma 1.500 0.000
ovarian cancer -1.100 0.000

Gene RIF (5)

PMID Text
27281218 CBFA2T2 forms a biochemical complex with PRDM14, a germline-specific transcription factor; mechanistically, CBFA2T2 oligomerizes to form a scaffold upon which PRDM14 and OCT4 are stabilized on chromatin
22443175 The MTGR1 gene depends on a GC-box-rich sequence for transcriptional regulation and possible ubiquitous expression.
20520637 report characterization of two chimeric transcripts identified in AML translocation cases involving CBFA2T2 and C20orf112
19026687 These results reveal novel contributions of MTGR1 and GFI1 to the regulation of neurite outgrowth and identify novel repressors of integrin-dependent neurite outgrowth.
18586123 ETO family member-mediated oligomerization and repression can be distinct events and that interaction between ETO family members and hSIN3B or N-CoR may not necessarily strengthen transcriptional repression.

AA Sequence

MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALS      1 - 70
NGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEK     71 - 140
VRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHL    141 - 210
LLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNP    211 - 280
GGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRDRHHSLGLNGGYQDELVDHRLTEREWADEWKH    281 - 350
LDHALNCIMEMVEKTRRSMAVLRRCQESDREELNYWKRRYNENTELRKTGTELVSRQHSPGSADSLSNDS    351 - 420
QREFNSRPGTGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAA    421 - 490
EDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLL    491 - 560
PVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNGL                              561 - 604
//

Text Mined References (33)

PMID Year Title
27281218 2016 Co-repressor CBFA2T2 regulates pluripotency and germline development.
26115422 2015 PAX5 alterations in genetically unclassified childhood Precursor B-cell acute lymphoblastic leukaemia.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23251453 2012 Kaiso directs the transcriptional corepressor MTG16 to the Kaiso binding site in target promoters.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22443175 2012 The leukemia associated nuclear corepressor ETO homologue genes MTG16 and MTGR1 are regulated differently in hematopoietic cells.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20520637 2010 CBFA2T2 and C20orf112: two novel fusion partners of RUNX1 in acute myeloid leukemia.
More...