Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.04
PubTator Score 8.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Leukemia 104 3.411 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
group 3 medulloblastoma 1.400 9.7e-03
intraductal papillary-mucinous carcinoma... 1.200 2.8e-02
lung cancer 1.500 3.8e-03
lung carcinoma 1.500 7.5e-19
medulloblastoma, large-cell 1.100 2.2e-04
osteosarcoma 1.313 3.4e-04
ovarian cancer -1.100 6.2e-05
psoriasis -2.500 1.5e-05
tuberculosis -1.100 4.8e-04

Gene RIF (6)

AA Sequence

MAKESGISLKEIQVLARQWKVGPEKRVPAMPGSPVEVKIQSRSSPPTMPPLPPINPGGPRPVSFTPTALS      1 - 70
NGINHSPPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEK     71 - 140
VRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLAQHEHL    141 - 210
LLNTSIASPADSSELLMEVHGNGKRPSPERREENSFDRDTIAPEPPAKRVCTISPAPRHSPALTVPLMNP    211 - 280
GGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRDRHHSLGLNGGYQDELVDHRLTEREWADEWKH    281 - 350
LDHALNCIMEMVEKTRRSMAVLRRCQESDREELNYWKRRYNENTELRKTGTELVSRQHSPGSADSLSNDS    351 - 420
QREFNSRPGTGYVPVEFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAA    421 - 490
EDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQNLHGQSPHGQGRPLL    491 - 560
PVGRGSSARSADCSVPSPALDKTSATTSRSSTPASVTAIDTNGL                              561 - 604
//

Text Mined References (35)

PMID Year Title