Property Summary

NCBI Gene PubMed Count 25
PubMed Score 16.96
PubTator Score 19.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 1.50226342880991E-31
osteosarcoma 7933 9.72225524330074E-7
psoriasis 6685 4.30689703595678E-6
lung adenocarcinoma 2714 7.27706364816104E-6
Amyotrophic Lateral Sclerosis 432 7.86243491124084E-6
ovarian cancer 8492 1.12135559942697E-5
hepatocellular carcinoma 550 7.06486923847827E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 2.85335276126124E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 4.13648979720318E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.64963413792847E-4
Rheumatoid Arthritis 1171 0.00320346885896995
lung cancer 4473 0.00606708482005936
primary pancreatic ductal adenocarcinoma 1271 0.00787242273545891
X-linked recessive Emery-Dreifuss muscular dystrophy 18 0.00970920101196483
astrocytic glioma 2241 0.011246148270798
gastric carcinoma 832 0.0223255055894941
oligodendroglioma 2849 0.0238524175063273
tuberculosis 1563 0.0278014007611705
ependymoma 2514 0.0287908024057317
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Spinocerebellar ataxia type 6 3 3.78 1.9
Sertoli cell-only syndrome 36 3.459 1.7

Expression

Synonym

Accession O43432 B9EGQ7 Q15597 Q504Z1 Q5SWC3 Q8NEN1 eIF-4-gamma 3
Symbols eIF4G 3
eIF4GII
eIF-4G 3

Gene

PDB

1HU3  

  Ortholog (7)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MNSQPQTRSPFFQRPQIQPPRATIPNSSPSIRPGAQTPTAVYQANQHIMMVNHLPMPYPVPQGPQYCIPQ      1 - 70
YRHSGPPYVGPPQQYPVQPPGPGPFYPGPGPGDFPNAYGTPFYPSQPVYQSAPIIVPTQQQPPPAKREKK     71 - 140
TIRIRDPNQGGKDITEEIMSGGGSRNPTPPIGRPTSTPTPPQQLPSQVPEHSPVVYGTVESAHLAASTPV    141 - 210
TAASDQKQEEKPKPDPVLKSPSPVLRLVLSGEKKEQEGQTSETTAIVSIAELPLPPSPTTVSSVARSTIA    211 - 280
APTSSALSSQPIFTTAIDDRCELSSPREDTIPIPSLTSCTETSDPLPTNENDDDICKKPCSVAPNDIPLV    281 - 350
SSTNLINEINGVSEKLSATESIVEIVKQEVLPLTLELEILENPPEEMKLECIPAPITPSTVPSFPPTPPT    351 - 420
PPASPPHTPVIVPAAATTVSSPSAAITVQRVLEEDESIRTCLSEDAKEIQNKIEVEADGQTEEILDSQNL    421 - 490
NSRRSPVPAQIAITVPKTWKKPKDRTRTTEEMLEAELELKAEEELSIDKVLESEQDKMSQGFHPERDPSD    491 - 560
LKKVKAVEENGEEAEPVRNGAESVSEGEGIDANSGSTDSSGDGVTFPFKPESWKPTDTEGKKQYDREFLL    561 - 630
DFQFMPACIQKPEGLPPISDVVLDKINQPKLPMRTLDPRILPRGPDFTPAFADFGRQTPGGRGVPLLNVG    631 - 700
SRRSQPGQRREPRKIITVSVKEDVHLKKAENAWKPSQKRDSQADDPENIKTQELFRKVRSILNKLTPQMF    701 - 770
NQLMKQVSGLTVDTEERLKGVIDLVFEKAIDEPSFSVAYANMCRCLVTLKVPMADKPGNTVNFRKLLLNR    771 - 840
CQKEFEKDKADDDVFEKKQKELEAASAPEERTRLHDELEEAKDKARRRSIGNIKFIGELFKLKMLTEAIM    841 - 910
HDCVVKLLKNHDEESLECLCRLLTTIGKDLDFEKAKPRMDQYFNQMEKIVKERKTSSRIRFMLQDVIDLR    911 - 980
LCNWVSRRADQGPKTIEQIHKEAKIEEQEEQRKVQQLMTKEKRRPGVQRVDEGGWNTVQGAKNSRVLDPS    981 - 1050
KFLKITKPTIDEKIQLVPKAQLGSWGKGSSGGAKASETDALRSSASSLNRFSALQPPAPSGSTPSTPVEF   1051 - 1120
DSRRTLTSRGSMGREKNDKPLPSATARPNTFMRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNS   1121 - 1190
TEAERNKTRESAKPEISAMSAHDKAALSEEELERKSKSIIDEFLHINDFKEAMQCVEELNAQGLLHVFVR   1191 - 1260
VGVESTLERSQITRDHMGQLLYQLVQSEKLSKQDFFKGFSETLELADDMAIDIPHIWLYLAELVTPMLKE   1261 - 1330
GGISMRELTIEFSKPLLPVGRAGVLLSEILHLLCKQMSHKKVGALWREADLSWKDFLPEGEDVHNFLLEQ   1331 - 1400
KLDFIESDSPCSSEALSKKELSAEELYKRLEKLIIEDKANDEQIFDWVEANLDEIQMSSPTFLRALMTAV   1401 - 1470
CKAAIIADSSTFRVDTAVIKQRVPILLKYLDSDTEKELQALYALQASIVKLDQPANLLRMFFDCLYDEEV   1471 - 1540
ISEDAFYKWESSKDPAEQNGKGVALKSVTAFFTWLREAEEESEDN                            1541 - 1585
//

Text Mined References (36)

PMID Year Title
25335168 2014 Common variants at 1p36 are associated with superior frontal gyrus volume.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...