Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.07
PubTator Score 6.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
THAUVIN-ROBINET-FAIVRE SYNDROME 1 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 1.5e-08
ovarian cancer 8520 2.1e-06
lung cancer 4740 2.7e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Disease Target Count Z-score Confidence
Coloboma 51 3.261 1.6
Achondroplasia 21 3.211 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
lung cancer 1.600 2.7e-05
ovarian cancer 2.000 2.1e-06
tuberculosis 1.100 1.5e-08

Gene RIF (4)

AA Sequence

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLL      1 - 70
HAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDN     71 - 140
FKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNW    141 - 210
TLGAVGEAPTDPDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFK    211 - 280
NLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRY    281 - 350
MGTLRGCLLRLYHD                                                            351 - 364
//

Text Mined References (22)

PMID Year Title