Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.07
PubTator Score 6.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis 1.100 0.000
lung cancer 1.600 0.000
ovarian cancer 2.000 0.000

Synonym

Accession O43427 A8K0J7 Q27Q85 Q6IBQ3 Q9HD65 aFGF intracellular-binding protein
Symbols FGFIBP
FIBP-1
TROFAS

Gene

Gene RIF (3)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17497037 Data Show aFGF was expressed in regenerative hepatocytes, but not in fibroblasts, suggesting its role in promoting oxidative stress produced by hepatocytes may contribute to the development of fibrous bands in hepatic cirrhosis.

AA Sequence

MTSELDIFVGNTTLIDEDVYRLWLDGYSVTDAVALRVRSGILEQTGATAAVLQSDTMDHYRTFHMLERLL      1 - 70
HAPPKLLHQLIFQIPPSRQALLIERYYAFDEAFVREVLGKKLSKGTKKDLDDISTKTGITLKSCRRQFDN     71 - 140
FKRVFKVVEEMRGSLVDNIQQHFLLSDRLARDYAAIVFFANNRFETGKKKLQYLSFGDFAFCAELMIQNW    141 - 210
TLGAVGEAPTDPDSQMDDMDMDLDKEFLQDLKELKVLVADKDLLDLHKSLVCTALRGKLGVFSEMEANFK    211 - 280
NLSRGLVNVAAKLTHNKDVRDLFVDLVEKFVEPCRSDHWPLSDVRFFLNQYSASVHSLDGFRHQALWDRY    281 - 350
MGTLRGCLLRLYHD                                                            351 - 364
//

Text Mined References (20)

PMID Year Title
25096995 2014 Proteomic analysis of the human cyclin-dependent kinase family reveals a novel CDK5 complex involved in cell growth and migration.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
23382103 2013 Platelet proteome analysis reveals integrin-dependent aggregation defects in patients with myelodysplastic syndromes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17497037 2007 Angiogenic factor expression in hepatic cirrhosis.
More...