Property Summary

NCBI Gene PubMed Count 50
PubMed Score 62.01
PubTator Score 40.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Parkinson's disease 392 3.661 1.8
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Down syndrome 499 3.87 1.9
Oculocerebrorenal syndrome 29 3.859 1.9

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.900 5.2e-06
astrocytic glioma -1.500 3.2e-03
Astrocytoma, Pilocytic -1.200 7.3e-06
atypical teratoid / rhabdoid tumor -2.400 7.7e-07
ependymoma -1.900 2.3e-02
glioblastoma -1.500 5.0e-07
group 3 medulloblastoma -1.200 1.8e-03
lung cancer -1.300 7.3e-03
medulloblastoma, large-cell -3.100 2.7e-07
oligodendroglioma -1.100 3.5e-02
ovarian cancer -2.500 4.0e-10
Pick disease -2.400 1.0e-04
primitive neuroectodermal tumor -1.400 4.4e-05
tuberculosis and treatment for 6 months 1.200 2.8e-03

Gene RIF (18)

AA Sequence

MAFSKGFRIYHKLDPPPFSLIVETRHKEECLMFESGAVAVLSSAEKEAIKGTYSKVLDAYGLLGVLRLNL      1 - 70
GDTMLHYLVLVTGCMSVGKIQESEVFRVTSTEFISLRIDSSDEDRISEVRKVLNSGNFYFAWSASGISLD     71 - 140
LSLNAHRSMQEQTTDNRFFWNQSLHLHLKHYGVNCDDWLLRLMCGGVEIRTIYAAHKQAKACLISRLSCE    141 - 210
RAGTRFNVRGTNDDGHVANFVETEQVVYLDDSVSSFIQIRGSVPLFWEQPGLQVGSHRVRMSRGFEANAP    211 - 280
AFDRHFRTLKNLYGKQIIVNLLGSKEGEHMLSKAFQSHLKASEHAADIQMVNFDYHQMVKGGKAEKLHSV    281 - 350
LKPQVQKFLDYGFFYFNGSEVQRCQSGTVRTNCLDCLDRTNSVQAFLGLEMLAKQLEALGLAEKPQLVTR    351 - 420
FQEVFRSMWSVNGDSISKIYAGTGALEGKAKLKDGARSVTRTIQNNFFDSSKQEAIDVLLLGNTLNSDLA    421 - 490
DKARALLTTGSLRVSEQTLQSASSKVLKSMCENFYKYSKPKKIRVCVGTWNVNGGKQFRSIAFKNQTLTD    491 - 560
WLLDAPKLAGIQEFQDKRSKPTDIFAIGFEEMVELNAGNIVSASTTNQKLWAVELQKTISRDNKYVLLAS    561 - 630
EQLVGVCLFVFIRPQHAPFIRDVAVDTVKTGMGGATGNKGAVAIRMLFHTTSLCFVCSHFAAGQSQVKER    631 - 700
NEDFIEIARKLSFPMGRMLFSHDYVFWCGDFNYRIDLPNEEVKELIRQQNWDSLIAGDQLINQKNAGQVF    701 - 770
RGFLEGKVTFAPTYKYDLFSDDYDTSEKCRTPAWTDRVLWRRRKWPFDRSAEDLDLLNASFQDESKILYT    771 - 840
WTPGTLLHYGRAELKTSDHRPVVALIDIDIFEVEAEERQNIYKEVIAVQGPPDGTVLVSIKSSLPENNFF    841 - 910
DDALIDELLQQFASFGEVILIRFVEDKMWVTFLEGSSALNVLSLNGKELLNRTITIALKSPDWIKNLEEE    911 - 980
MSLEKISIALPSSTSSTLLGEDAEVAADFDMEGDVDDYSAEVEELLPQHLQPSSSSGLGTSPSSSPRTSP    981 - 1050
CQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQSSPIDAQPATPLPQKDPAQPLEPKRPPPPRPVAPPTRP   1051 - 1120
APPQRPPPPSGARSPAPTRKEFGGIGAPPSPGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAG   1121 - 1190
YSTARPTIPPRAGVISAPQSHARASAGRLTPESQSKTSETSKGSTFLPEPLKPQAAFPPQSSLPPPAQRL   1191 - 1260
QEPLVPVAAPMPQSGPQPNLETPPQPPPRSRSSHSLPSEASSQPQVKTNGISDGKRESPLKIDPFEDLSF   1261 - 1330
NLLAVSKAQLSVQTSPVPTPDPKRLIQLPSATQSNVLSSVSCMPTMPPIPARSQSQENMRSSPNPFITGL   1331 - 1400
TRTNPFSDRTAAPGNPFRAKSEESEATSWFSKEEPVTISPFPSLQPLGHNKSRASSSLDGFKDSFDLQGQ   1401 - 1470
STLKISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPP   1471 - 1540
PPVPLLPPGTSPPVDPFTTLASKASPTLDFTER                                        1541 - 1573
//

Text Mined References (58)

PMID Year Title