Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 10.33

Knowledge Summary

Patent

No data available

Gene RIF (5)

PMID Text
26112988 results highlight that certain malignancies with ANP32C/D overexpression or mutation might be specifically targeted using Hsp90 inhibitors.
24398589 pp32r1 binds to HuR to avoid the caspase-mediated decay of HuR in the cytoplasm of cells.
24335183 These findings highlight that certain cancers overexpressing pp32r1 or pp32r1 mutants are likely to demonstrate enhanced resistance to FTY720 treatment.
23403278 CHD4 were significantly upregulated by pp32r1 and pp32r1Y140H overexpression which influence a number of cell cycle regulator genes including p53, p21 and cyclinD1
15146458 expression levels vary among human tumor cell lines, with the highest levels found in prostatic adenocarcinoma cell lines

AA Sequence

MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLEL      1 - 70
RVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTY     71 - 140
LDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGY    141 - 210
NDGEVDGEEDEEELGEEERGQKRK                                                  211 - 234
//

Text Mined References (13)

PMID Year Title
26112988 2015 Oncogenic acidic nuclear phosphoproteins ANP32C/D are novel clients of heat shock protein 90.
24398589 2014 pp32r1 controls the decay of the RNA-binding protein HuR.
24335183 2014 Overexpression of the pp32r1 (ANP32C) oncogene or its functional mutant pp32r1Y140H confers enhanced resistance to FTY720 (Finguimod).
23403278 2013 Dysregulation of cell cycle control caused by overexpression of the oncogene pp32r1 (ANP32C) and the Tyr>His mutant pp32r1Y140H.
15895553 2005 The Anp32 family of proteins containing leucine-rich repeats.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15146458 2004 Identification of a functional mutation in pp32r1 (ANP32C).
12524539 2003 Cleaving the oxidative repair protein Ape1 enhances cell death mediated by granzyme A.
11678310 2001 Expression of pp32 gene family members in breast cancer.
11360199 2001 Tumor suppression and potentiation by manipulation of pp32 expression.
More...