Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.00
PubTator Score 10.33

Knowledge Summary

Patent

No data available

Gene RIF (5)

AA Sequence

MEMGRRIHSELRNRAPSDVKELALDNSRSNEGKLEALTDEFEELEFLSKINGGLTSISDLPKLKLRKLEL      1 - 70
RVSGGLEVLAEKCPNLTHLYLSGNKIKDLSTIEPLKQLENLKSLDLFNCEVTNLNDYGENVFKLLLQLTY     71 - 140
LDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGY    141 - 210
NDGEVDGEEDEEELGEEERGQKRK                                                  211 - 234
//

Text Mined References (13)

PMID Year Title