Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 4
Funding $173,711.12
PubMed Score 2.37
PubTator Score 2.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.531 0.000
esophageal adenocarcinoma 1.100 0.030
posterior fossa group A ependymoma 1.100 0.000

Synonym

Accession O43422 A8K728 Q17RY9 Q8WTW1 Q9Y3Z4 p52rIPK
Symbols DAP4
THAP0
PRKRIR
P52rIPK

Gene

PANTHER Protein Class (1)

Gene RIF (4)

PMID Text
21910972 PRKRIR provides a novel positive regulator controlling the RIG-I-IFN production system through protein stability control.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
12384512 role in promoting MST1-induced apoptosis by enabling colocalization of MST with p53

AA Sequence

MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRT      1 - 70
SPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNP     71 - 140
SEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRIN    141 - 210
SGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLV    211 - 280
RFVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEK    281 - 350
YPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELK    351 - 420
EICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVL    421 - 490
SFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAH    491 - 560
QGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRS    561 - 630
DLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENG    631 - 700
RKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT             701 - 761
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21910972 2011 A protein-kinase, IFN-inducible double-stranded RNA dependent inhibitor and repressor of p58 (PRKRIR) enhances type I IFN-mediated antiviral response through the stability control of RIG-I protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15863623 2005 The THAP domain of THAP1 is a large C2CH module with zinc-dependent sequence-specific DNA-binding activity.
More...