Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.37
PubTator Score 2.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
posterior fossa group A ependymoma 468 1.7e-06
Multiple myeloma 1332 3.1e-04
esophageal adenocarcinoma 737 3.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Gastric cardia adenocarcinoma 3 3.988 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
esophageal adenocarcinoma 1.100 3.0e-02
Multiple myeloma 1.531 3.1e-04
posterior fossa group A ependymoma 1.100 1.7e-06

Gene RIF (4)

AA Sequence

MPNFCAAPNCTRKSTQSDLAFFRFPRDPARCQKWVENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRT      1 - 70
SPYRTVLRDNAIPTIFDLTSHLNNPHSRHRKRIKELSEDEIRTLKQKKIDETSEQEQKHKETNNSNAQNP     71 - 140
SEEEGEGQDEDILPLTLEEKENKEYLKSLFEILILMGKQNIPLDGHEADEIPEGLFTPDNFQALLECRIN    141 - 210
SGEEVLRKRFETTAVNTLFCSKTQQRQMLEICESCIREETLREVRDSHFFSIITDDVVDIAGEEHLPVLV    211 - 280
RFVDESHNLREEFIGFLPYEADAEILAVKFHTMITEKWGLNMEYCRGQAYIVSSGFSSKMKVVASRLLEK    281 - 350
YPQAIYTLCSSCALNMWLAKSVPVMGVSVALGTIEEVCSFFHRSPQLLLELDNVISVLFQNSKERGKELK    351 - 420
EICHSQWTGRHDAFEILVELLQALVLCLDGINSDTNIRWNNYIAGRAFVLCSAVSDFDFIVTIVVLKNVL    421 - 490
SFTRAFGKNLQGQTSDVFFAAGSLTAVLHSLNEVMENIEVYHEFWFEEATNLATKLDIQMKLPGKFRRAH    491 - 560
QGNLESQLTSESYYKETLSVPTVEHIIQELKDIFSEQHLKALKCLSLVPSVMGQLKFNTSEEHHADMYRS    561 - 630
DLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENG    631 - 700
RKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT             701 - 761
//

Text Mined References (22)

PMID Year Title