Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.41
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.700 0.000
non primary Sjogren syndrome sicca 1.500 0.012
ovarian cancer 1.500 0.000
Breast cancer 1.200 0.000

Synonym

Accession O43402 C9JB21
Symbols NOC4
COX4NB
C16orf2
C16orf4
FAM158B

Gene

Gene RIF (4)

PMID Text
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19724895 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPM      1 - 70
LEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPT     71 - 140
IHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC    141 - 210
//

Text Mined References (15)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22119785 2011 Defining human ERAD networks through an integrative mapping strategy.
21269460 2011 Initial characterization of the human central proteome.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19946888 2010 Defining the membrane proteome of NK cells.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19724895 2009 Association of gene polymorphisms with chronic kidney disease in Japanese individuals.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
More...