Property Summary

NCBI Gene PubMed Count 23
PubMed Score 217.87
PubTator Score 47.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 4.5767884928965E-17
ovarian cancer 8492 5.82552420389227E-7
sonic hedgehog group medulloblastoma 1482 1.90361474687934E-6
ependymoma 2514 1.99153929575362E-5
atypical teratoid / rhabdoid tumor 4369 2.11768444417614E-5
medulloblastoma, large-cell 6234 7.42930779939638E-5
Multiple myeloma 1328 1.59417646482248E-4
pediatric high grade glioma 2712 1.66015644322925E-4
pituitary cancer 1972 2.21798973105713E-4
primitive neuroectodermal tumor 3031 6.09560552380927E-4
glioblastoma 5572 8.36197658443375E-4
Waldenstrons macroglobulinemia 765 0.001854938014409
invasive ductal carcinoma 2950 0.00226821796138332
pancreatic ductal adenocarcinoma liver metastasis 1795 0.019489404739811
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.02793091929905
osteosarcoma 7933 0.0314005950645603

Expression

Synonym

Accession O43396
Symbols Txl
TXNL
TRP32
TXL-1
HEL-S-114

Gene

PANTHER Protein Class (1)

PDB

1GH2   1WWY  

  Ortholog (14)

Gene RIF (10)

PMID Text
24525731 TXNL1-XRCC1 is a novel regulatory pathway that has an independent role in cisplatin resistance, indicating a putative drug target for reversing cisplatin resistance in gastric cancer.
24525731 TXNL1 is a novel regulatory molecule that inhibits cisplatin resistance in gastric cancer cells.
23362275 Results suggest that TRP32 maintains the reduced state of PRL and thus regulates the biological function of PRL.
21290163 Distinct protein expression patterns, affecting TXNL1 and HDAC2, distinguish aneuploid with poor prognosis from diploid colorectal cancers.
20455272 Solution structure of the C-terminal DUF1000 domain of the human thioredoxin-like 1 protein.
19349280 TRP32 was identified as a novel subunit of the 26 S proteasome.
19349277 Txnl1 is the first example of a direct connection between protein reduction and proteolysis, two major intracellular protein quality control mechanisms.
17987124 TXNL1 acts as an effector of oxidants or a redox sensor by converting redox changes into changes of GDI capacity to capture Rab5, which in turn modulates fluid phase endocytosis
16385451 Observational study of gene-disease association. (HuGE Navigator)
16231315 results imply that TRP-1 is a mammalian thioredoxin and plays as a transcriptional repressor through direct binding to the transcription factor B-Myb

AA Sequence

MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVDVHQCQGTAAT      1 - 70
NNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIPKGYMDLMPFINKAGCECLNE     71 - 140
SDEHGFDNCLRKDTTFLESDCDEQLLITVAFNQPVKLYSMKFQGPDNGQGPKYVKIFINLPRSMDFEEAE    141 - 210
RSEPTQALELTEDDIKEDGIVPLRYVKFQNVNSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKR    211 - 280
VVGKKGESH                                                                 281 - 289
//

Text Mined References (27)

PMID Year Title
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24525731 2014 TXNL1-XRCC1 pathway regulates cisplatin-induced cell death and contributes to resistance in human gastric cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362275 2013 Thioredoxin-related protein 32 (TRP32) specifically reduces oxidized phosphatase of regenerating liver (PRL).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21290163 2011 HDAC2 and TXNL1 distinguish aneuploid from diploid colorectal cancers.
21269460 2011 Initial characterization of the human central proteome.
20455272 2010 Solution structure of the C-terminal DUF1000 domain of the human thioredoxin-like 1 protein.
More...