Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.01
PubTator Score 10.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
Breast cancer 3099 4.78873198586176E-13
juvenile dermatomyositis 1189 1.20401023379476E-9
osteosarcoma 7933 2.40994580547513E-7
acute quadriplegic myopathy 1157 5.84186506483058E-6
Amyotrophic Lateral Sclerosis 432 8.56952237561903E-6
cystic fibrosis 1670 1.82459429926698E-5
lung adenocarcinoma 2714 2.03515801511422E-5
Multiple myeloma 1328 3.85627595028585E-5
Pick disease 1893 6.01237551008781E-5
medulloblastoma, large-cell 6234 6.82808841011211E-5
ovarian cancer 8492 1.86065986814522E-4
psoriasis 6685 3.2454049547339E-4
lung cancer 4473 0.00132962588979331
group 3 medulloblastoma 2254 0.00168702599146806
dermatomyositis 967 0.0016910214555709
Waldenstrons macroglobulinemia 765 0.00286731087599438
breast carcinoma 1614 0.00380101989538679
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00470842958162226
oligodendroglioma 2849 0.00943404577862495
ependymoma 2514 0.0428132932334327
Disease Target Count Z-score Confidence
Spinal muscular atrophy 24 3.949 2.0

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.026 0.003
Multiple myeloma 2.026 0.000
ependymoma -1.400 0.043
oligodendroglioma -1.700 0.009
psoriasis 1.300 0.000
osteosarcoma 2.374 0.000
group 3 medulloblastoma 1.300 0.002
medulloblastoma, large-cell 1.300 0.000
juvenile dermatomyositis 1.098 0.000
Amyotrophic Lateral Sclerosis 1.126 0.000
acute quadriplegic myopathy 1.574 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.005
lung cancer 1.300 0.001
breast carcinoma 1.500 0.004
cystic fibrosis -1.100 0.000
lung adenocarcinoma 1.318 0.000
Pick disease 1.100 0.000
Breast cancer -1.300 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.100 0.002

Synonym

Accession O43390 Q2L7G6 Q5TEH1 Q9BV64 S4R3J4 hnRNP R
Symbols HNRPR
hnRNP-R

Gene

PDB

2DK2  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (8)

PMID Text
25338097 SMN is involved in the axonal translocation of hnRNP R and hnRNP R-bound RNA/protein complexes.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: HNRNPR.
19808671 Data demonstrate that expression levels of hnRNP A1, Q, K, R, and U influence HIV-1 production by persistently infected astrocytes, linking these hnRNPs to HIV replication.
19808671 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19581295 HNRNPR enhanced transcription from the c-fos promoter.
17672918 validated occurrence of an unusual TG 3' splice site in intron 7

AA Sequence

MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALRE      1 - 70
FNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDV     71 - 140
TTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAF    141 - 210
ITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYH    211 - 280
QPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLAT    281 - 350
TVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ    351 - 420
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPY    421 - 490
YGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRG    491 - 560
SRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQ    561 - 630
QWK                                                                       631 - 633
//

Text Mined References (41)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25338097 2014 Presynaptic localization of Smn and hnRNP R in axon terminals of embryonic and postnatal mouse motoneurons.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23967313 2013 Heterogeneous nuclear ribonucleoprotein R cooperates with mediator to facilitate transcription reinitiation on the c-Fos gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...