Property Summary

NCBI Gene PubMed Count 31
PubMed Score 10.10
PubTator Score 10.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.574 5.8e-06
Amyotrophic lateral sclerosis 1.126 8.6e-06
Breast cancer -1.300 4.8e-13
breast carcinoma 1.500 3.8e-03
cystic fibrosis -1.100 1.8e-05
dermatomyositis 1.100 1.7e-03
ependymoma -1.400 4.3e-02
group 3 medulloblastoma 1.300 1.7e-03
intraductal papillary-mucinous carcinoma... 1.200 4.7e-03
juvenile dermatomyositis 1.098 1.2e-09
lung adenocarcinoma 1.318 2.0e-05
lung cancer 1.300 1.3e-03
medulloblastoma, large-cell 1.300 6.8e-05
Multiple myeloma 1.087 8.8e-04
oligodendroglioma -1.700 9.4e-03
osteosarcoma 2.374 2.4e-07
ovarian cancer -1.500 1.9e-04
Pick disease 1.100 6.0e-05
psoriasis 1.300 3.2e-04
Waldenstrons macroglobulinemia 2.026 2.9e-03

Protein-protein Interaction (4)

Gene RIF (9)

AA Sequence

MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALRE      1 - 70
FNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDV     71 - 140
TTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAF    141 - 210
ITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYH    211 - 280
QPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLAT    281 - 350
TVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ    351 - 420
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPY    421 - 490
YGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRG    491 - 560
SRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQ    561 - 630
QWK                                                                       631 - 633
//

Text Mined References (43)

PMID Year Title