Property Summary

NCBI Gene PubMed Count 30
PubMed Score 10.01
PubTator Score 10.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 2.026 0.003
Multiple myeloma 2.026 0.000
ependymoma -1.400 0.043
oligodendroglioma -1.700 0.009
psoriasis 1.300 0.000
osteosarcoma 2.374 0.000
group 3 medulloblastoma 1.300 0.002
medulloblastoma, large-cell 1.300 0.000
juvenile dermatomyositis 1.098 0.000
Amyotrophic Lateral Sclerosis 1.126 0.000
acute quadriplegic myopathy 1.574 0.000
intraductal papillary-mucinous carcinoma... 1.200 0.005
lung cancer 1.300 0.001
breast carcinoma 1.500 0.004
cystic fibrosis -1.100 0.000
lung adenocarcinoma 1.318 0.000
Pick disease 1.100 0.000
Breast cancer -1.300 0.000
ovarian cancer -1.500 0.000
dermatomyositis 1.100 0.002

Synonym

Accession O43390 Q2L7G6 Q5TEH1 Q9BV64 S4R3J4 hnRNP R
Symbols HNRPR
hnRNP-R

Gene

PDB

2DK2  

Gene RIF (11)

PMID Text
25338097 SMN is involved in the axonal translocation of hnRNP R and hnRNP R-bound RNA/protein complexes.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22174317 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: HNRNPR.
19808671 Data demonstrate that expression levels of hnRNP A1, Q, K, R, and U influence HIV-1 production by persistently infected astrocytes, linking these hnRNPs to HIV replication.
19808671 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein R (HNRNPR), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19581295 HNRNPR enhanced transcription from the c-fos promoter.
More...

AA Sequence

MANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALRE      1 - 70
FNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDV     71 - 140
TTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAF    141 - 210
ITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYH    211 - 280
QPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLAT    281 - 350
TVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQ    351 - 420
AARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPY    421 - 490
YGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRG    491 - 560
SRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQ    561 - 630
QWK                                                                       631 - 633
//

Text Mined References (41)

PMID Year Title
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25338097 2014 Presynaptic localization of Smn and hnRNP R in axon terminals of embryonic and postnatal mouse motoneurons.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23967313 2013 Heterogeneous nuclear ribonucleoprotein R cooperates with mediator to facilitate transcription reinitiation on the c-Fos gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
More...