Property Summary

NCBI Gene PubMed Count 12
PubMed Score 299.18
PubTator Score 178.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.600 8.2e-03
ependymoma 1.200 2.8e-02
malignant mesothelioma 1.400 2.1e-05
oligodendroglioma 1.500 4.0e-03
osteosarcoma -1.387 6.0e-04
tuberculosis and treatment for 6 months 1.100 2.0e-05

Gene RIF (4)

AA Sequence

MAKRSSLYIRIVEGKNLPAKDITGSSDPYCIVKVDNEPIIRTATVWKTLCPFWGEEYQVHLPPTFHAVAF      1 - 70
YVMDEDALSRDDVIGKVCLTRDTIASHPKGFSGWAHLTEVDPDEEVQGEIHLRLEVWPGARACRLRCSVL     71 - 140
EARDLAPKDRNGTSDPFVRVRYKGRTRETSIVKKSCYPRWNETFEFELQEGAMEALCVEAWDWDLVSRND    141 - 210
FLGKVVIDVQRLRVVQQEEGWFRLQPDQSKSRRHDEGNLGSLQLEVRLRDETVLPSSYYQPLVHLLCHEV    211 - 280
KLGMQGPGQLIPLIEETTSTECRQDVATNLLKLFLGQGLAKDFLDLLFQLELSRTSETNTLFRSNSLASK    281 - 350
SMESFLKVAGMQYLHGVLGPIINKVFEEKKYVELDPSKVEVKDVGCSGLHRPQTEAEVLEQSAQTLRAHL    351 - 420
GALLSALSRSVRACPAVVRATFRQLFRRVRERFPGAQHENVPFIAVTSFLCLRFFSPAIMSPKLFHLRER    421 - 490
HADARTSRTLLLLAKAVQNVGNMDTPASRAKEAWMEPLQPTVRQGVAQLKDFITKLVDIEEKDELDLQRT    491 - 560
LSLQAPPVKEGPLFIHRTKGKGPLMSSSFKKLYFSLTTEALSFAKTPSSKKSALIKLANIRAAEKVEEKS    561 - 630
FGGSHVMQVIYTDDAGRPQTAYLQCKCVNELNQWLSALRKVSINNTGLLGSYHPGVFRGDKWSCCHQKEK    631 - 700
TGQGCDKTRSRVTLQEWNDPLDHDLEAQLIYRHLLGVEAMLWERHRELSGGAEAGTVPTSPGKVPEDSLA    701 - 770
RLLRVLQDLREAHSSSPAGSPPSEPNCLLELQT                                         771 - 803
//

Text Mined References (12)

PMID Year Title