Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 9
Funding $632,742.33
PubMed Score 194.46
PubTator Score 31.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -2.100 0.000
psoriasis -1.300 0.001
osteosarcoma -1.361 0.003
lung cancer -1.400 0.005
posterior fossa group A ependymoma 2.000 0.000
non-inflammatory breast cancer -1.200 0.000

 GO Component (1)

Gene RIF (7)

PMID Text
26496426 The Hoxa2-mediated decay of RCHY1 involves both the 19S and 20S proteasome complexes
24243817 HOXA2 acts as a suppressor or TBP-antagonist to inhibit MMP-9 expression; while methylation-mediated inactivation of HOXA2 in NPC derepresses MMP-9 production and increases invasion of NPC cells.
23775976 we have identified a nonsense mutation (Q235*) in HOXA2 that segregates with bilateral nonsyndromic microtia and hearing loss through three generations of a family in an autosomal dominant pattern.
20542577 Lack of mutations in the coding region of HOXA2 among the sporadic microtia patients.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
18394579 A missense mutation in the HOXA2 in a consanguineous iranian family with bilateral microtia was reported.

AA Sequence

MNYEFEREIGFINSQPSLAECLTSFPPVADTFQSSSIKTSTLSHSTLIPPPFEQTIPSLNPGSHPRHGAG      1 - 70
GRPKPSPAGSRGSPVPAGALQPPEYPWMKEKKAAKKTALLPAAAAAATAAATGPACLSHKESLEIADGSG     71 - 140
GGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENQNS    141 - 210
EGKCKSLEDSEKVEEDEEEKTLFEQALSVSGALLEREGYTFQQNALSQQQAPNGHNGDSQSFPVSPLTSN    211 - 280
EKNLKHFQHQSPTVPNCLSTMGQNCGAGLNNDSPEALEVPSLQDFSVFSTDSCLQLSDAVSPSLPGSLDS    281 - 350
PVDISADSLDFFTDTLTTIDLQHLNY                                                351 - 376
//

Text Mined References (16)

PMID Year Title
26496426 2015 Molecular Analysis of the HOXA2-Dependent Degradation of RCHY1.
24243817 2013 Aberrantly hypermethylated Homeobox A2 derepresses metalloproteinase-9 through TBP and promotes invasion in Nasopharyngeal carcinoma.
23775976 2013 HOXA2 haploinsufficiency in dominant bilateral microtia and hearing loss.
20542577 2010 Mutational analysis of HOXA2 and SIX2 in a Bronx population with isolated microtia.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
18394579 2008 A mutation in HOXA2 is responsible for autosomal-recessive microtia in an Iranian family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...