Property Summary

Ligand Count 18
NCBI Gene PubMed Count 116
PubMed Score 107.30
PubTator Score 220.61

Knowledge Summary

Patent (123,209)

Expression

  Differential Expression (10)

Disease log2 FC p
ulcerative colitis 1.800 7.9e-07
acute myeloid leukemia 1.200 3.4e-02
astrocytic glioma 1.200 2.3e-02
gastric cancer -1.100 1.1e-03
glioblastoma 1.300 1.2e-03
hepatocellular carcinoma -1.200 6.8e-06
invasive ductal carcinoma 1.100 1.7e-03
lung carcinoma -1.800 7.1e-21
malignant mesothelioma -1.500 3.0e-07
posterior fossa group A ependymoma 1.100 1.5e-07

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (72)

AA Sequence

MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEIL      1 - 70
HKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTP     71 - 140
PLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKH    141 - 210
DIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDER    211 - 280
PSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ    281 - 350
LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN    351 - 420
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQL    421 - 490
LDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM                        491 - 540
//

Text Mined References (129)

PMID Year Title