Property Summary

NCBI Gene PubMed Count 107
Grant Count 38
R01 Count 27
Funding $2,343,872.44
PubMed Score 103.86
PubTator Score 220.61

Knowledge Summary

Patent (123,209)

Expression

  Differential Expression (10)

Disease log2 FC p
ulcerative colitis 1.800 0.000
gastric cancer -1.100 0.001
hepatocellular carcinoma -1.200 0.000
malignant mesothelioma -1.500 0.000
astrocytic glioma 1.200 0.023
glioblastoma 1.300 0.001
posterior fossa group A ependymoma 1.100 0.000
lung carcinoma -1.800 0.000
invasive ductal carcinoma 1.100 0.002
acute myeloid leukemia 1.200 0.034

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (67)

PMID Text
26646181 RIP2 and RhoGDI bind to p75(NTR) death domain at partially overlapping epitopes with over 100-fold difference in affinity, revealing the mechanism by which RIP2 recruitment displaces RhoGDI upon ligand binding.
26466644 Barettin has inhibitory activity against two protein kinases related to inflammation, namely the receptor-interacting serine/threonine kinase 2 (RIPK2) and calcium/calmodulin-dependent protein kinase 1alpha (CAMK1alpha).
26463597 up-regulated in failing hearts
26297639 RIPK1 and RIPK2 are targets of HIV-1 Protease activity during infection, and their inactivation may contribute to modulation of cell death and host defense pathways by HIV-1
26297639 HIV-1 PR (WT, not D25N) cleaves over-expressed RIPK2 with high specificity and this cleavage is prevent by addition of Saquinavir (protease inhibitor)
26297639 HIV-1 PR (WT, not D25N) cleaves over-expressed RIPK2 with high specificity and this cleavage is prevent by addition of Saquinavir (protease inhibitor)
26130752 that Rip2 modifies VEGF-induced signalling and vascular permeability in myocardial ischaemia
26040030 Changes in the expression levels of IRS1, IRS2, RIPK2, RSPO1, and DNA JC15 genes might contribute to the development of insulin resistance and glucose intolerance in the obese boys.
25374171 RIP2 protein, human is involved in human colon tumorigenesis and could be a predictive marker for colon carcinoma progression
24958724 the NOD1-RIP2 signaling axis is more complex than previously assumed, that simple engagement of RIP2 is insufficient to mediate signaling
More...

AA Sequence

MNGEAICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLHIHTPLLDSERKDVLREAEIL      1 - 70
HKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTP     71 - 140
PLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRSSKSAPEGGTIIYMPPENYEPGQKSRASIKH    141 - 210
DIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDER    211 - 280
PSFLKCLIELEPVLRTFEEITFLEAVIQLKKTKLQSVSSAIHLCDKKKMELSLNIPVNHGPQEESCGSSQ    281 - 350
LHENSGSPETSRSLPAPQDNDFLSRKAQDCYFMKLHHCPGNHSWDSTISGSQRAAFCDHKTTPCSSAIIN    351 - 420
PLSTAGNSERLQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQL    421 - 490
LDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM                        491 - 540
//

Text Mined References (120)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26646181 2015 Structural basis of death domain signaling in the p75 neurotrophin receptor.
26466644 2015 The immunomodulatory effects of barettin and involvement of the kinases CAMK1? and RIPK2.
26463597 2015 Regulatory role of CARD3 in left ventricular remodelling and dysfunction after myocardial infarction.
26297639 2015 HIV-1 protease cleaves the serine-threonine kinases RIPK1 and RIPK2.
26130752 2015 Rip2 modifies VEGF-induced signalling and vascular permeability in myocardial ischaemia.
26040030 2015 The expression of CCN2, IQSEC, RSPO1, DNAJC15, RIPK2, IL13RA2, IRS1, and IRS2 genes in blood of obese boys with insulin resistance.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
25416956 2014 A proteome-scale map of the human interactome network.
25374171 2014 hARIP2 is a putative growth-promoting factor involved in human colon tumorigenesis.
More...