Property Summary

NCBI Gene PubMed Count 70
PubMed Score 110.63
PubTator Score 125.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.413 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 2.0e-04
group 3 medulloblastoma 1.100 1.2e-04
lung cancer 1.200 1.8e-03
medulloblastoma, large-cell 1.600 1.3e-04
primitive neuroectodermal tumor 1.200 8.9e-05
psoriasis -1.100 5.9e-14

Gene RIF (60)

AA Sequence

METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD      1 - 70
QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAML     71 - 140
MFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAF    141 - 210
MLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAA    211 - 280
AVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGG    281 - 350
PLIATAFTNGYH                                                              351 - 362
//

Text Mined References (75)

PMID Year Title