Property Summary

NCBI Gene PubMed Count 62
Grant Count 23
R01 Count 9
Funding $1,701,402.67
PubMed Score 99.67
PubTator Score 125.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
group 4 medulloblastoma 2.300 0.000
atypical teratoid / rhabdoid tumor 1.500 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.200 0.000
lung cancer 1.200 0.002
psoriasis -1.100 0.000

Gene RIF (52)

PMID Text
27281208 studies highlight Msi reporters as a unique tool to identify therapy resistance, and define Msi signalling as a central regulator of pancreatic cancer
26673327 Concomitant loss of function of both MSI1 is sufficient to abrogate the growth of human colorectal cancer cells, and Msi gene deletion inhibits tumorigenesis in several mouse models of intestinal cancer.
26294058 Msi1 overexpression is associated with Esophageal Squamous Cell Carcinoma.
26191146 Suggest high level of Musashi-1 protein expression is associated with poor survival in endometrioid adenocarcinoma patients.
26100017 The findings uncover a role for MSI1 as a central regulator of cell adhesion pathways that contribute to Glioblastoma by influencing cell adhesion, morphology, migration, and invasion.
25971681 Musashi-1 and ALDH1 expression are closely related to metastasis of ovarian adenocarcinoma.
25940441 Our results demonstrate that miR-137 acts as a tumor-suppressive miRNA in colorectal cancers and negatively regulates oncogenic Musashi-1
25888190 data suggest that in response to environmental cues that oppose cell cycle progression, regulation of Musashi function is required to promote target mRNA translation and cell fate transition
25851660 This review highlights both the essential contribution of RBPs to posttranscriptional regulation and the importance of the Musashi family as master regulators of male gamete development--{REVIEW}
25773390 we suggest that Musashi-1, Lgr5, and pEGFR are overexpressed in human SIAs and may play roles in human SIA carcinogenesis and progression.
More...

AA Sequence

METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMD      1 - 70
QAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAML     71 - 140
MFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAF    141 - 210
MLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAA    211 - 280
AVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGG    281 - 350
PLIATAFTNGYH                                                              351 - 362
//

Text Mined References (67)

PMID Year Title
27281208 2016 Image-based detection and targeting of therapy resistance in pancreatic adenocarcinoma.
26673327 2015 The Msi Family of RNA-Binding Proteins Function Redundantly as Intestinal Oncoproteins.
26294058 2015 Role of Msi1 and MAML1 in Regulation of Notch Signaling Pathway in Patients with Esophageal Squamous Cell Carcinoma.
26191146 2015 Prognostic value of Musashi-1 in endometrioid adenocarcinoma.
26100017 2015 RNA-Binding Protein Musashi1 Is a Central Regulator of Adhesion Pathways in Glioblastoma.
25971681 2015 Musashi-1 Expression is a Prognostic Factor in Ovarian Adenocarcinoma and Correlates with ALDH-1 Expression.
25940441 2015 Tumor suppressive microRNA-137 negatively regulates Musashi-1 and colorectal cancer progression.
25888190 2015 Neural stem and progenitor cell fate transition requires regulation of Musashi1 function.
25851660 RNA binding proteins in spermatogenesis: an in depth focus on the Musashi family.
25773390 2015 Correlation of Musashi-1, Lgr5, and pEGFR expressions in human small intestinal adenocarcinomas.
More...