Property Summary

NCBI Gene PubMed Count 11
PubMed Score 10.72
PubTator Score 8.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.730 0.000
pancreatic ductal adenocarcinoma liver m... -1.454 0.007
acute myeloid leukemia 1.400 0.023
ovarian cancer -1.200 0.000

Gene RIF (5)

PMID Text
22820890 alpha-LA protects 3T3-L1 adipocytes from LYRM1-induced insulin resistance partially via its capacity to restore mitochondrial function and/or increase phosphorylation of IRS-1 and Akt.
20938407 Data suggest that LYRM1 might have the potential to modulate cell growth, apoptosis, and heart development.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20826099 overexpression of LYRM1 caused mitochondrial dysfunction in adipocytes, which might be responsible for the development of LYRM1-induced insulin resistance
19022914 By increasing cell proliferation and lowering the rate of apoptosis, LYRM1 has the potential to modulate the size of the preadipocyte pool and influence adipose tissue homeostasis

AA Sequence

MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTAR      1 - 70
IEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS                       71 - 122
//

Text Mined References (12)

PMID Year Title
24845505 2014 DNA microarray analysis of genes differentially expressed in adipocyte differentiation.
22820890 2012 ?-Lipoic acid ameliorates impaired glucose uptake in LYRM1 overexpressing 3T3-L1 adipocytes through the IRS-1/Akt signaling pathway.
20938407 2010 LYRM1, a gene that promotes proliferation and inhibits apoptosis during heart development.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20826099 2010 Overexpression of LYRM1 induces mitochondrial impairment in 3T3-L1 adipocytes.
19284880 2009 Identification of candidate genes for human pituitary development by EST analysis.
19022914 2009 LYRM1, a novel gene promotes proliferation and inhibits apoptosis of preadipocytes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...