Property Summary

NCBI Gene PubMed Count 31
PubMed Score 11.73
PubTator Score 13.42

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
Pick disease 1893 5.29124920543226E-5
lung cancer 4473 9.02682542087623E-5
colon cancer 1475 2.30009131969929E-4
invasive ductal carcinoma 2950 6.32224696205608E-4
astrocytoma 1493 0.018040041509903
ovarian cancer 8492 0.0235982413467354


  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.600 0.018
lung cancer 3.600 0.000
colon cancer 1.600 0.000
Pick disease -1.300 0.000
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.100 0.024


Accession O43324 C9JLK5 Q5THS2
Symbols P18



2UZ8   4BL7   4BVX   4BVY   5BMU  

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (13)

26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25465621 AIMP3 was shown to be involved in the cellular aging of human mesenchymal stem cells.
24104880 Identification of EEf1E1 and OBFC2B as novel BRCA1-partner genes in the DNA double-strand break repair pathway.
23306449 AIMP3 stabilizes and protects methionyl-tRNA synthetase and eIF2gamma through the binding interactions.
22944692 Positional proteomics analysis identifies the cleavage of human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1) at amino acid residues 9-10 by the HIV-1 protease
22867704 AIMP3 is a critical mediator of Met-tRNA(i)(Met) transfer from methionyl-tRNA synthetase to eIF2 complex for the accurate and efficient translation initiation
22190034 Positional proteomics analysis identifies the cleavage of human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1) at amino acid residues 9-10 by the HIV-1 protease
22106287 Data show that aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3)/p18 is released from aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3) by UV irradiation-induced stress.
21789020 Decreased expression of AIMP3 in gastric and colorectal cancer tissues suggests that down-regulation of this protein may be related to inactivation of the tumor suppressor functions of AIMP proteins and might play a role in the development of GC and CRC.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19024604 No EEF1E1 mutations were detected in human cancer specimens.
18343821 analysis of the three-dimensional structure and residues of the novel tumor suppressor AIMP3/p18 required for the interaction with
15680327 p18 is a haploinsufficient tumor suppressor and a key factor for ATM/ATR-mediated p53 activation.

AA Sequence

NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH                                        141 - 174

Text Mined References (33)

PMID Year Title
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25465621 2014 miR-543 and miR-590-3p regulate human mesenchymal stem cell aging via direct targeting of AIMP3/p18.
25416956 2014 A proteome-scale map of the human interactome network.
24104880 2013 Identification of two novel BRCA1-partner genes in the DNA double-strand break repair pathway.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23306449 2013 Contributions of aminoacyl-tRNA synthetase-interacting multifunctional protein-3 to mammalian translation initiation.
22867704 2012 AIMP3/p18 controls translational initiation by mediating the delivery of charged initiator tRNA to initiation complex.
22190034 2011 Global landscape of HIV-human protein complexes.
22106287 2011 Dual role of methionyl-tRNA synthetase in the regulation of translation and tumor suppressor activity of aminoacyl-tRNA synthetase-interacting multifunctional protein-3.
21789020 Expression of AIMP1, 2 and 3, the scaffolds for the multi-tRNA synthetase complex, is downregulated in gastric and colorectal cancer.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19024604 2008 Absence of somatic mutation of a tumor suppressor gene eukaryotic translation elongation factor 1, epsilon-1 (EEF1E1), in common human cancers.
18343821 2008 Determination of three-dimensional structure and residues of the novel tumor suppressor AIMP3/p18 required for the interaction with ATM.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16055448 2005 The C-terminal appended domain of human cytosolic leucyl-tRNA synthetase is indispensable in its interaction with arginyl-tRNA synthetase in the multi-tRNA synthetase complex.
15680327 2005 The haploinsufficient tumor suppressor p18 upregulates p53 via interactions with ATM/ATR.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11714285 2001 The appended C-domain of human methionyl-tRNA synthetase has a tRNA-sequestering function.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
9278442 1997 Human lysyl-tRNA synthetase accepts nucleotide 73 variants and rescues Escherichia coli double-defective mutant.
8449960 1993 Expression of human aspartyl-tRNA synthetase in Escherichia coli. Functional analysis of the N-terminal putative amphiphilic helix.
8188258 1994 The human EPRS locus (formerly the QARS locus): a gene encoding a class I and a class II aminoacyl-tRNA synthetase.
8078941 1994 Evolution of the Glx-tRNA synthetase family: the glutaminyl enzyme as a case of horizontal gene transfer.
8052601 1994 Human cytoplasmic isoleucyl-tRNA synthetase: selective divergence of the anticodon-binding domain and acquisition of a new structural unit.