Property Summary

NCBI Gene PubMed Count 34
PubMed Score 12.48
PubTator Score 13.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Pick disease 1894 5.3e-05
lung cancer 4740 9.0e-05
colon cancer 1478 2.3e-04
invasive ductal carcinoma 2951 6.3e-04
astrocytoma 1146 1.8e-02
ovarian cancer 8520 2.4e-02
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 0.9

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.600 1.8e-02
colon cancer 1.600 2.3e-04
invasive ductal carcinoma 1.300 6.3e-04
lung cancer 3.600 9.0e-05
ovarian cancer 1.100 2.4e-02
Pick disease -1.300 5.3e-05

Gene RIF (14)

AA Sequence

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAI      1 - 70
VQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL     71 - 140
NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH                                        141 - 174
//

Text Mined References (36)

PMID Year Title