Property Summary

NCBI Gene PubMed Count 31
PubMed Score 11.73
PubTator Score 13.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma -1.600 0.018
lung cancer 3.600 0.000
colon cancer 1.600 0.000
Pick disease -1.300 0.000
invasive ductal carcinoma 1.300 0.001
ovarian cancer 1.100 0.024

Synonym

Accession O43324 C9JLK5 Q5THS2
Symbols P18
AIMP3

Gene

PDB

2UZ8   4BL7   4BVX   4BVY   5BMU  

Gene RIF (13)

PMID Text
26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25465621 AIMP3 was shown to be involved in the cellular aging of human mesenchymal stem cells.
24104880 Identification of EEf1E1 and OBFC2B as novel BRCA1-partner genes in the DNA double-strand break repair pathway.
23306449 AIMP3 stabilizes and protects methionyl-tRNA synthetase and eIF2gamma through the binding interactions.
22944692 Positional proteomics analysis identifies the cleavage of human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1) at amino acid residues 9-10 by the HIV-1 protease
22867704 AIMP3 is a critical mediator of Met-tRNA(i)(Met) transfer from methionyl-tRNA synthetase to eIF2 complex for the accurate and efficient translation initiation
22190034 Positional proteomics analysis identifies the cleavage of human eukaryotic translation elongation factor 1 epsilon 1 (EEF1E1) at amino acid residues 9-10 by the HIV-1 protease
22106287 Data show that aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3)/p18 is released from aminoacyl-tRNA synthetase-interacting multifunctional protein-3 (AIMP3) by UV irradiation-induced stress.
21789020 Decreased expression of AIMP3 in gastric and colorectal cancer tissues suggests that down-regulation of this protein may be related to inactivation of the tumor suppressor functions of AIMP proteins and might play a role in the development of GC and CRC.
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAI      1 - 70
VQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYL     71 - 140
NVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH                                        141 - 174
//

Text Mined References (33)

PMID Year Title
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25465621 2014 miR-543 and miR-590-3p regulate human mesenchymal stem cell aging via direct targeting of AIMP3/p18.
25416956 2014 A proteome-scale map of the human interactome network.
24104880 2013 Identification of two novel BRCA1-partner genes in the DNA double-strand break repair pathway.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23306449 2013 Contributions of aminoacyl-tRNA synthetase-interacting multifunctional protein-3 to mammalian translation initiation.
22867704 2012 AIMP3/p18 controls translational initiation by mediating the delivery of charged initiator tRNA to initiation complex.
22190034 2011 Global landscape of HIV-human protein complexes.
22106287 2011 Dual role of methionyl-tRNA synthetase in the regulation of translation and tumor suppressor activity of aminoacyl-tRNA synthetase-interacting multifunctional protein-3.
More...