Property Summary

NCBI Gene PubMed Count 23
PubMed Score 171.17
PubTator Score 48.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0

Expression

Protein-protein Interaction (6)

Gene RIF (12)

AA Sequence

MALLTNLLPLCCLALLALPAQSCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARG      1 - 70
SERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSL     71 - 140
HYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGGCFPGNATVRLWS    141 - 210
GERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPA    211 - 280
PAPGDFAPVFARRLRAGDSVLAPGGDALRPARVARVAREEAVGVFAPLTAHGTLLVNDVLASCYAVLESH    281 - 350
QWAHRAFAPLRLLHALGALLPGGAVQPTGMHWYSRLLYRLAEELLG                            351 - 396
//

Text Mined References (23)

PMID Year Title