Property Summary

NCBI Gene PubMed Count 16
PubMed Score 57.51
PubTator Score 31.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6694 7.0e-07
Disease Target Count Z-score Confidence
Scotoma 22 3.016 1.5
Disease Target Count
FGF16 1

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 7.0e-07

Synonym

Accession O43320 FGF-16
Symbols MF4
FGF-16

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (5)

AA Sequence

MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTG      1 - 70
FHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFE     71 - 140
ENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR       141 - 207
//

Text Mined References (20)

PMID Year Title