Property Summary

NCBI Gene PubMed Count 15
Grant Count 13
R01 Count 11
Funding $1,120,269.53
PubMed Score 54.53
PubTator Score 31.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Gene RIF (4)

PMID Text
24878828 Identification of an FGF16 mutation in metacarpal 4-5 fusion.
24706454 impaired FGF16 function may also be responsible for connective tissue symptoms in MF4 patients.
20097674 Fgf-16 gene is a target for NF-kappaB activation in the postnatal heart.
16756958 HUVEC clearly demonstrated chemotaxis towards FGF16. FGF16 enhanced cell migration in response to mechanical damage & failed to induce endothelial cell proliferation or sprouting in a three-dimensional in vitro angiogenesis assay.

AA Sequence

MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGILRRRQLYCRTG      1 - 70
FHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNERGELYGSKKLTRECVFREQFE     71 - 140
ENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRHQKFTHFLPRPVDPSKLPSMSRDLFHYR       141 - 207
//

Text Mined References (19)

PMID Year Title
25333065 2014 Identification of three novel FGF16 mutations in X-linked recessive fusion of the fourth and fifth metacarpals and possible correlation with heart disease.
24878828 2014 Identification of a novel familial FGF16 mutation in metacarpal 4-5 fusion.
24706454 2014 Further evidence for FGF16 truncating mutations as the cause of X-linked recessive fusion of metacarpals 4 / 5.
24253043 2014 FGF16 promotes invasive behavior of SKOV-3 ovarian cancer cells through activation of mitogen-activated protein kinase (MAPK) signaling pathway.
23709756 2013 Whole exome sequencing identifies FGF16 nonsense mutations as the cause of X-linked recessive metacarpal 4/5 fusion.
20097674 2010 FGF-16 is a target for adrenergic stimulation through NF-kappaB activation in postnatal cardiac cells and adult mouse heart.
20094046 2010 Fibroblast growth factor signalling: from development to cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18565327 2008 FGF-16 is required for embryonic heart development.
16756958 2006 Fibroblast growth factor 16 and 18 are expressed in human cardiovascular tissues and induce on endothelial cells migration but not proliferation.
More...