Property Summary

NCBI Gene PubMed Count 201
Grant Count 19
R01 Count 15
Funding $1,453,418.14
PubMed Score 27.97
PubTator Score 268.41

Knowledge Summary

Patent (24,014)

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis -1.300 0.001
osteosarcoma 1.560 0.000
group 4 medulloblastoma 1.300 0.001
glioblastoma 1.100 0.028
atypical teratoid / rhabdoid tumor 1.300 0.000
juvenile dermatomyositis 1.171 0.000
acute quadriplegic myopathy 1.148 0.000
primary pancreatic ductal adenocarcinoma 1.098 0.006
lung cancer 1.100 0.003
lung adenocarcinoma 1.005 0.000
ovarian cancer 2.500 0.000
dermatomyositis 1.300 0.001

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (148)

PMID Text
27048361 This paper highlights that targeting the BMP and TGFbeta type I and type II receptors causes a downregulation of XIAP, TAK1, and Id1 leading to cell death of lung cancer cells.
26823762 TAK1 may be an important factor involved in the pathogenesis of thyroid cancer, and targeted down-regulation of TAK1 may improve the prognosis of patients with thyroid cancer.
26491199 The data emphasize the central role of TAK1 in controlling signaling cascades and functional responses in primary neutrophils, making it a promising target for therapeutic intervention in view of the role of neutrophils in chronic inflammatory conditions.
26468522 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
26406417 Loss of MAP3K7 are associated with esophageal squamous cell carcinoma.
26401039 HIV-1 (NL43) Vpr S79A mutant, which no longer binds TAK1, demonstrates impaired ability to trigger TNF-alpha secretion from MT4C5 cells suggesting TAK1/Vpr interaction enhances TNF secretion from HIV-1 infected cells
26189595 Polyubiquitination of Transforming Growth Factor beta-activated Kinase 1 (TAK1) at Lysine 562 Residue Regulates TLR4-mediated JNK and p38 MAPK Activation
26185333 the TAK1 signaling pathway may represent a suitable target to design new, antifibrotic therapies
25889255 MiR-377 is an important negative regulator of E2F and MAP3K7/NF-kB signaling pathway in melanoma cells.
25770290 identify coordinate loss of MAP3K7 and CHD1 as a unique driver of aggressive prostate cancer development
More...

AA Sequence

MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESE      1 - 70
RKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQG     71 - 140
VAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTACDIQTHMTNNKGSAAWMAPEVFEGSNYSEKC    141 - 210
DVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEI    211 - 280
VKIMTHLMRYFPGADEPLQYPCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLES    281 - 350
KLLKNQAKQQSESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN    351 - 420
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHPWTPDDSTDTN    421 - 490
GSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKD    491 - 560
QQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS                            561 - 606
//

Text Mined References (219)

PMID Year Title
27426733 2016 Mutations in MAP3K7 that Alter the Activity of the TAK1 Signaling Complex Cause Frontometaphyseal Dysplasia.
27048361 2016 Inhibition of BMP and of TGF? receptors downregulates expression of XIAP and TAK1 leading to lung cancer cell death.
26823762 2015 The role of TAK1 expression in thyroid cancer.
26491199 2015 Activation of TAK1 by Chemotactic and Growth Factors, and Its Impact on Human Neutrophil Signaling and Functional Responses.
26406417 2015 Identification of genomic biomarkers associated with the clinicopathological parameters and prognosis of esophageal squamous cell carcinoma.
26189595 2015 Polyubiquitination of Transforming Growth Factor ?-activated Kinase 1 (TAK1) at Lysine 562 Residue Regulates TLR4-mediated JNK and p38 MAPK Activation.
26185333 2015 TAK1 is a key modulator of the profibrogenic phenotype of human ileal myofibroblasts in Crohn's disease.
25889255 2015 MiR-377 targets E2F3 and alters the NF-kB signaling pathway through MAP3K7 in malignant melanoma.
25770290 2015 Coordinate loss of MAP3K7 and CHD1 promotes aggressive prostate cancer.
25557171 2015 Targeting of TGF-?-activated protein kinase 1 inhibits chemokine (C-C motif) receptor 7 expression, tumor growth and metastasis in breast cancer.
More...