Property Summary

NCBI Gene PubMed Count 55
PubMed Score 146.63
PubTator Score 91.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (47)

AA Sequence

MHQDGISSMNQLGGLFVNGRPLPLDTRQQIVRLAVSGMRPCDISRILKVSNGCVSKILGRYYRTGVLEPK      1 - 70
GIGGSKPRLATPPVVARIAQLKGECPALFAWEIQRQLCAEGLCTQDKTPSVSSINRVLRALQEDQGLPCT     71 - 140
RLRSPAVLAPAVLTPHSGSETPRGTHPGTGHRNRTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLP    141 - 210
EDTVRVWFSNRRAKWRRQEKLKWEMQLPGASQGLTVPRVAPGIISAQQSPGSVPTAALPALEPLGPSCYQ    211 - 280
LCWATAPERCLSDTPPKACLKPCWDCGSFLLPVIAPSCVDVAWPCLDASLAHHLIGGAGKATPTHFSHWP    281 - 350
//

Text Mined References (56)

PMID Year Title