Property Summary

NCBI Gene PubMed Count 76
Grant Count 23
R01 Count 19
Funding $2,547,363.5
PubMed Score 146.26
PubTator Score 124.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Gene RIF (46)

PMID Text
26837049 Our findings implicate the involvement of AQP9 in H2O2 transport in human and mice cells.
26313002 the human aquaglyceroporins, i.e., AQP3, AQP7, AQP9 and AQP10 can act as silicon transporters in both Xenopus laevis oocytes and HEK-293 cells.
25604497 we suggest that AQP9 is involved in viral tropism and pathogenesis of Herpes simplex encephalitis
25105540 Oleic acid-induced hepatic steatosis in HepG2 cells is associated with the coordinated regulation of aquaporin 3 and aquaporin 9 via activation of p38 signaling
24643204 The genetic polymorphisms in OCT2, AQP2, AQP9 and TMEM205 may contribute to chemotherapy response in lung cancer patients.
24463099 REVIEW: the current knowledge on the role of the glycerol channels AQP7 and AQP9 in controlling glycerol metabolism in adipose tissue and liver
24418844 AQP9 downregulation together with the subsequent reduction in hepatic glycerol permeability in insulin-resistant states emerges as a compensatory mechanism whereby the liver counteracts further triacylglycerol accumulation
24086629 AQP9 expressing glioma cells were negative for the brain tumor stem cell marker CD15.
23866971 Placental expression of the arsenic transporter AQP9 was positively associated with maternal urinary arsenic levels during pregnancy. AQP9 expression related to phospholipase ENPP2 expression which was positively associated with infant birth weight.
23612070 AQP9 expression is lower in patients with stage III colorectal cancer who do not respond to adjuvant chemotherapy
More...

AA Sequence

MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAM      1 - 70
AIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVG     71 - 140
ENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLN    141 - 210
SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTE    211 - 280
QSEDKPEKYELSVIM                                                           281 - 295
//

Text Mined References (77)

PMID Year Title
26837049 2016 Aquaporin-9 facilitates membrane transport of hydrogen peroxide in mammalian cells.
26313002 2015 Aquaporins Mediate Silicon Transport in Humans.
25604497 2015 The anterior commissure is a pathway for contralateral spread of herpes simplex virus type 1 after olfactory tract infection.
25105540 2015 Oleic acid-induced hepatic steatosis is coupled with downregulation of aquaporin 3 and upregulation of aquaporin 9 via activation of p38 signaling.
24643204 2014 The association of transporter genes polymorphisms and lung cancer chemotherapy response.
24463099 2014 Metabolic impact of the glycerol channels AQP7 and AQP9 in adipose tissue and liver.
24418844 2014 Reduced hepatic aquaporin-9 and glycerol permeability are related to insulin resistance in non-alcoholic fatty liver disease.
24086629 2013 AQP9 expression in glioblastoma multiforme tumors is limited to a small population of astrocytic cells and CD15(+)/CalB(+) leukocytes.
23866971 2013 Association between In Utero arsenic exposure, placental gene expression, and infant birth weight: a US birth cohort study.
23612070 2013 Multi-microarray identifies lower AQP9 expression in adjuvant chemotherapy nonresponders with stage III colorectal cancer.
More...