Property Summary

NCBI Gene PubMed Count 11
Grant Count 7
R01 Count 5
Funding $414,850.24
PubMed Score 16.60
PubTator Score 26.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Rheumatoid Arthritis 1.600 0.016
sonic hedgehog group medulloblastoma 1.300 0.000
primitive neuroectodermal tumor 1.100 0.000
colon cancer -1.200 0.011
diabetes mellitus -1.300 0.005
ovarian cancer 1.600 0.000

Synonym

Accession O43314 A1NI53 A6NGS8 Q8TB50
Symbols VIP2
IP7K2
CFAP160
HISPPD1

Gene

PDB

3T54   3T7A   3T99   3T9A   3T9B   3T9C   3T9D   3T9E   3T9F   4HN2   4NZM   4NZN   4NZO   4Q4C   4Q4D   5BYA   5BYB   5DGH   5DGI  

Gene RIF (5)

PMID Text
26204995 SEZ6L, HISPPD1, FEZF1, SAMD11 gene variants may be associated with autism spectrum disorder.
26084399 The degree of nuclear localization of hPPIP5K2 was increased when S1006 was rendered non-phosphorylatable by its mutation to Ala.
23240582 the specificity constants for PPIP5K2 revise upwards by one-to-two orders of magnitude the inherent catalytic activities of this enzyme, and we show its equilibrium point favours 80-90% depletion of InsP/-InsP.
22119861 describe the PPIP5K2's conformational dynamics, its unprecedented topological presentation of nucleotide and inositol phosphate, and the charge balance that facilitates partly associative in-line phosphoryl transfer
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MSEAPRFFVGPEDTEINPGNYRHFFHHADEDDEEEDDSPPERQIVVGICSMAKKSKSKPMKEILERISLF      1 - 70
KYITVVVFEEEVILNEPVENWPLCDCLISFHSKGFPLDKAVAYAKLRNPFVINDLNMQYLIQDRREVYSI     71 - 140
LQAEGILLPRYAILNRDPNNPKECNLIEGEDHVEVNGEVFQKPFVEKPVSAEDHNVYIYYPTSAGGGSQR    141 - 210
LFRKIGSRSSVYSPESNVRKTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEV    211 - 280
RYPVILNAREKLIAWKVCLAFKQTVCGFDLLRANGQSYVCDVNGFSFVKNSMKYYDDCAKILGNIVMREL    281 - 350
APQFHIPWSIPLEAEDIPIVPTTSGTMMELRCVIAVIRHGDRTPKQKMKMEVRHQKFFDLFEKCDGYKSG    351 - 420
KLKLKKPKQLQEVLDIARQLLMELGQNNDSEIEENKPKLEQLKTVLEMYGHFSGINRKVQLTYLPHGCPK    421 - 490
TSSEEEDSRREEPSLLLVLKWGGELTPAGRVQAEELGRAFRCMYPGGQGDYAGFPGCGLLRLHSTYRHDL    491 - 560
KIYASDEGRVQMTAAAFAKGLLALEGELTPILVQMVKSANMNGLLDSDSDSLSSCQQRVKARLHEILQKD    561 - 630
RDFTAEDYEKLTPSGSISLIKSMHLIKNPVKTCDKVYSLIQSLTSQIRHRMEDPKSSDIQLYHSETLELM    631 - 700
LRRWSKLEKDFKTKNGRYDISKIPDIYDCIKYDVQHNGSLKLENTMELYRLSKALADIVIPQEYGITKAE    701 - 770
KLEIAKGYCTPLVRKIRSDLQRTQDDDTVNKLHPVYSRGVLSPERHVRTRLYFTSESHVHSLLSILRYGA    771 - 840
LCNESKDEQWKRAMDYLNVVNELNYMTQIVIMLYEDPNKDLSSEERFHVELHFSPGAKGCEEDKNLPSGY    841 - 910
GYRPASRENEGRRPFKIDNDDEPHTSKRDEVDRAVILFKPMVSEPIHIHRKSPLPRSRKTATNDEESPLS    911 - 980
VSSPEGTGTWLHYTSGVGTGRRRRRSGEQITSSPVSPKSLAFTSSIFGSWQQVVSENANYLRTPRTLVEQ    981 - 1050
KQNPTVGSHCAGLFSTSVLGGSSSAPNLQDYARTHRKKLTSSGCIDDATRGSAVKRFSISFARHPTNGFE   1051 - 1120
LYSMVPSICPLETLHNALSLKQVDEFLASIASPSSDVPRKTAEISSTALRSSPIMRKKVSLNTYTPAKIL   1121 - 1190
PTPPATLKSTKASSKPATSGPSSAVVPNTSSRKKNITSKTETHEHKKNTGKKK                    1191 - 1243
//

Text Mined References (20)

PMID Year Title
26204995 2015 Whole exome sequencing in extended families with autism spectrum disorder implicates four candidate genes.
26084399 2015 Identification of a functional nuclear translocation sequence in hPPIP5K2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23240582 2013 The kinetic properties of a human PPIP5K reveal that its kinase activities are protected against the consequences of a deteriorating cellular bioenergetic environment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22119861 2011 Structural basis for an inositol pyrophosphate kinase surmounting phosphate crowding.
21269460 2011 Initial characterization of the human central proteome.
21222653 2011 Receptor-dependent compartmentalization of PPIP5K1, a kinase with a cryptic polyphosphoinositide binding domain.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...