Property Summary

NCBI Gene PubMed Count 18
PubMed Score 19.29
PubTator Score 12.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
juvenile dermatomyositis 1187 2.4e-10
ovarian cancer 8520 2.8e-06
medulloblastoma, large-cell 6241 1.1e-02
spina bifida 1074 2.3e-02
Breast cancer 3578 2.5e-02
Disease Target Count Z-score Confidence
Ataxia telangiectasia 34 3.285 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.400 2.5e-02
juvenile dermatomyositis 1.255 2.4e-10
medulloblastoma, large-cell -1.500 1.1e-02
ovarian cancer -1.300 2.8e-06
spina bifida -1.469 2.3e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (16)

AA Sequence

MAASEAAAAAGSAALAAGARAVPAATTGAAAAASGPWVPPGPRLRGSRPRPAGATQQPAVPAPPAGELIQ      1 - 70
PSVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPR     71 - 140
GPERPFSQFSLVKQHFMKMHAEKKHKCSKCSNSYGTEWDLKRHAEDCGKTFRCTCGCPYASRTALQSHIY    141 - 210
RTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCGSNTD    211 - 280
KQTLTTPPRYPQKLLLPKPKVALVKLPVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGT    281 - 350
LILGLDSEACSLKESLPLFKIANPIAGEPISTGVQVNFGKSPSNPLQELGNTCQKNSISSINVQTDLSYA    351 - 420
SQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPISVHTQTFLPSSKVTSSIAAQTDAFMDTCFQSGGVS    421 - 490
RETQTSGIESPTDDHVQMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPKTLNQDIE    491 - 560
KSAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHRSLLSDTNPGPDTQLPSGPAQ    561 - 630
NPGIDFDIEEFFSASNIQTQTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEMF    631 - 700
DTQTQTDLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAKNIPALESKVQLNSTETQTMSS    701 - 770
GFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAEPHTVSNF                     771 - 823
//

Text Mined References (21)

PMID Year Title