Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 10
Funding $1,345,460.67
PubMed Score 18.00
PubTator Score 12.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma, large-cell -1.500 0.011
juvenile dermatomyositis 1.255 0.000
Breast cancer 2.400 0.025
spina bifida -1.469 0.023
ovarian cancer -2.100 0.000

Gene RIF (12)

PMID Text
25262557 ATMIN is required for cell cycle progression and chromosome segregation following replication stress.ATMIN is required for the ATM-mediated signaling and recruitment of 53BP1 to DNA damage sites upon replication stress.
22167198 The ASCIZ-DYNLL1 feedback loop represents a novel mechanism for auto-regulation of gene expression, where the gene product directly inhibits the transcriptional activator while bound at its own promoter.
21971545 these results imply a potential cellular interference between DYNLL1 and ATMIN functions.
20975950 Absence of Asciz (Atmin) leads to increased oxidative and methylating DNA base damage sensitivity in primary fibroblasts
20975950 Asciz (Atmin) deletion or knock-down does not affect ATM levels and activation in mouse, chicken, or human cells
19844255 Observational study of gene-disease association. (HuGE Navigator)
18854154 Knockdown of ATM interactor (ATMIN) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18728389 ASCIZ (ATMIN) is structurally related to the yeast ATM/ATR substrate Mdt1 (Pin4/Ybl051c); both proteins contain SQ/TQ cluster domains and interact with N-terminal FHA domains of CHK2/Rad53 kinases.
18433721 These data suggest that ASCIZ may affect the choice between competing base repair pathways in a manner that reduces the amount of substrates available for Ig gene conversion.
17525732 ATMIN defines a novel NBS1-independent pathway of ATM signalling.
More...

AA Sequence

MAASEAAAAAGSAALAAGARAVPAATTGAAAAASGPWVPPGPRLRGSRPRPAGATQQPAVPAPPAGELIQ      1 - 70
PSVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQDGIVNPTIRKDLKTGPKFYCCPIEGCPR     71 - 140
GPERPFSQFSLVKQHFMKMHAEKKHKCSKCSNSYGTEWDLKRHAEDCGKTFRCTCGCPYASRTALQSHIY    141 - 210
RTGHEIPAEHRDPPSKKRKMENCAQNQKLSNKTIESLNNQPIPRPDTQELEASEIKLEPSFEDSCGSNTD    211 - 280
KQTLTTPPRYPQKLLLPKPKVALVKLPVMQFSVMPVFVPTADSSAQPVVLGVDQGSATGAVHLMPLSVGT    281 - 350
LILGLDSEACSLKESLPLFKIANPIAGEPISTGVQVNFGKSPSNPLQELGNTCQKNSISSINVQTDLSYA    351 - 420
SQNFIPSAQWATADSSVSSCSQTDLSFDSQVSLPISVHTQTFLPSSKVTSSIAAQTDAFMDTCFQSGGVS    421 - 490
RETQTSGIESPTDDHVQMDQAGMCGDIFESVHSSYNVATGNIISNSLVAETVTHSLLPQNEPKTLNQDIE    491 - 560
KSAPIINFSAQNSMLPSQNMTDNQTQTIDLLSDLENILSSNLPAQTLDHRSLLSDTNPGPDTQLPSGPAQ    561 - 630
NPGIDFDIEEFFSASNIQTQTEESELSTMTTEPVLESLDIETQTDFLLADTSAQSYGCRGNSNFLGLEMF    631 - 700
DTQTQTDLNFFLDSSPHLPLGSILKHSSFSVSTDSSDTETQTEGVSTAKNIPALESKVQLNSTETQTMSS    701 - 770
GFETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTSAEPHTVSNF                     771 - 823
//

Text Mined References (17)

PMID Year Title
25262557 2014 ATMIN is required for the ATM-mediated signaling and recruitment of 53BP1 to DNA damage sites upon replication stress.
22167198 2012 ATM substrate Chk2-interacting Zn2+ finger (ASCIZ) Is a bi-functional transcriptional activator and feedback sensor in the regulation of dynein light chain (DYNLL1) expression.
21971545 2011 LC8 dynein light chain (DYNLL1) binds to the C-terminal domain of ATM-interacting protein (ATMIN/ASCIZ) and regulates its subcellular localization.
20975950 2010 Dual functions of ASCIZ in the DNA base damage response and pulmonary organogenesis.
19844255 2010 Fine mapping and association studies of a high-density lipoprotein cholesterol linkage region on chromosome 16 in French-Canadian subjects.
19001856 2008 ATMINistrating ATM signalling: regulation of ATM by ATMIN.
18728389 2008 Mdt1/ASCIZ: a new DNA damage response protein family.
18433721 2008 DNA damage response protein ASCIZ links base excision repair with immunoglobulin gene conversion.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525732 2007 ATMIN defines an NBS1-independent pathway of ATM signalling.
More...